From a1597982ba42aa70e3aa6c67150f9a132bca7c7e Mon Sep 17 00:00:00 2001 From: kafitzgerald Date: Tue, 14 May 2024 15:48:37 +0000 Subject: [PATCH] deploy: 31951e6a03dc30d58e50547a55155cc8ef48b119 --- .../containerize-visualizations-event.md.txt | 42 + blog/2024/index.html | 63 ++ blog/archive/index.html | 12 + blog/atom.xml | 24 +- blog/author/index.html | 23 + blog/author/john-clyne/index.html | 656 ++++++++++++++ blog/index.html | 65 +- blog/tag/tutorial-hackathon-events/index.html | 63 ++ index.html | 7 + objects.inv | Bin 4100 -> 4166 bytes posts/2019/we-are-xdev/index.html | 14 +- posts/2020/Time/index.html | 14 +- .../python-tutorial-faq-part-2/index.html | 14 +- .../python-tutorial-faq-part-3/index.html | 14 +- posts/2020/python-tutorial-faq/index.html | 14 +- .../index.html | 14 +- posts/2020/tutorial-seminar-series/index.html | 14 +- .../index.html | 14 +- posts/2021/Interactive_Dashboard/index.html | 14 +- .../advanced-plotting-tutorial/index.html | 14 +- .../index.html | 14 +- posts/2021/cartopy-tutorial/index.html | 14 +- posts/2021/casper_pbs_dask/index.html | 14 +- posts/2021/cesm-datashader/index.html | 14 +- .../cesm-workshop-2021-diagnostics/index.html | 14 +- posts/2021/dask-summit-takeaway/index.html | 14 +- posts/2021/dask-tutorial-update/index.html | 14 +- posts/2021/dask-tutorial/index.html | 14 +- .../ecgtools-history-files-example/index.html | 14 +- posts/2021/esds-blog/index.html | 14 +- .../2021/esds-update-november-2021/index.html | 14 +- .../2021/esds-update-october-2021/index.html | 14 +- .../esds-update-september-2021/index.html | 14 +- posts/2021/geocat-comp-tutorial/index.html | 14 +- posts/2021/geocat-tutorial/index.html | 14 +- posts/2021/git-and-github-tutorial/index.html | 14 +- posts/2021/graphviz_example/index.html | 14 +- .../intake-cesm2-le-glade-example/index.html | 14 +- .../intake-esm-derived-variables/index.html | 14 +- .../index.html | 14 +- .../2021/intake-esm-tutorial-2021/index.html | 14 +- .../intake-obs-cesm2le-comparison/index.html | 14 +- posts/2021/intake_cmip6_debug/index.html | 14 +- posts/2021/intake_esm_dask/index.html | 14 +- .../index.html | 14 +- posts/2021/jupyter-notebooks-faq/index.html | 14 +- posts/2021/kay-et-al-cesm2-le/index.html | 14 +- posts/2021/map_blocks_example/index.html | 14 +- posts/2021/matplotlib-faq/index.html | 14 +- posts/2021/matplotlib-tutorial/index.html | 14 +- .../index.html | 14 +- .../multiple_index_xarray_xoak/index.html | 14 +- posts/2021/ncar-jobqueue-example/index.html | 14 +- posts/2021/numpy-faq/index.html | 14 +- posts/2021/numpy-tutorial/index.html | 14 +- .../index.html | 14 +- posts/2021/oop-tutorial/index.html | 14 +- posts/2021/paired_programming_vs/index.html | 14 +- posts/2021/pandas-tutorial/index.html | 14 +- posts/2021/project-pythia-overview/index.html | 14 +- .../index.html | 14 +- .../regrid-observations-pop-grid/index.html | 14 +- .../index.html | 14 +- posts/2021/scipy-2021-takeaways/index.html | 14 +- posts/2021/software-citation/index.html | 14 +- .../index.html | 14 +- posts/2021/xarray-tutorial/index.html | 14 +- posts/2021/xarray-wrf-example/index.html | 14 +- posts/2021/yearly-averages-xarray/index.html | 14 +- .../index.html | 14 +- posts/2022/Thinking-with-Xarray/index.html | 14 +- .../index.html | 14 +- posts/2022/cam-se-regridding/index.html | 14 +- posts/2022/dask-debug-detrend/index.html | 14 +- posts/2022/debugging/index.html | 14 +- posts/2022/esds-event-prep/index.html | 14 +- posts/2022/esds-event-recap/index.html | 14 +- posts/2022/esds-fall-event/index.html | 14 +- posts/2022/metpy_tutorial/index.html | 14 +- .../2022/office-hours-appointments/index.html | 14 +- posts/2022/sparse-PFT-gridding/index.html | 14 +- .../index.html | 14 +- posts/2022/yourfirst/index.html | 14 +- posts/2023/cam-se-analysis/index.html | 14 +- .../cesm2-le-timeseries-kerchunk/index.html | 14 +- posts/2023/esds-annual-event/index.html | 14 +- posts/2023/kerchunk-mom6/index.html | 14 +- posts/2023/mfdataset/index.html | 14 +- posts/2023/office-hours-help/index.html | 14 +- posts/2023/scipy23/index.html | 14 +- .../unstructured-grid-collab-1/index.html | 14 +- .../index.html | 833 ++++++++++++++++++ posts/2024/esds-annual-event-recap/index.html | 22 +- searchindex.js | 2 +- 94 files changed, 2369 insertions(+), 577 deletions(-) create mode 100644 _sources/posts/2024/containerize-visualizations-event.md.txt create mode 100644 blog/author/john-clyne/index.html create mode 100644 posts/2024/containerize-visualizations-event/index.html diff --git a/_sources/posts/2024/containerize-visualizations-event.md.txt b/_sources/posts/2024/containerize-visualizations-event.md.txt new file mode 100644 index 000000000..b827454b4 --- /dev/null +++ b/_sources/posts/2024/containerize-visualizations-event.md.txt @@ -0,0 +1,42 @@ +--- +author: John Clyne +date: 2024-05-07 +tags: tutorial hackathon events +--- + +# Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations + +The [ESDS Events Working Group](https://ncar.github.io/esds/about/#events-working-group) is hosting a hybrid workshop on June 20th, from 9am until noon. + + +The event will be hosted at the Mesa Lab, located at 1850 Table +Mesa Dr, Boulder, CO 80305. In order to attend the event virtually, +registered participants will receive an email from Taysia +Peterson roughly one week prior to the event with Zoom details. + +## Registration + +*Coming soon* + +## What is it? + +This workshop guides participants through the process of transforming +an interactive visualization from a Jupyter Notebook into a +Python-based web server. Attendees will learn how to create and run +a containerized version of the web server, gaining practical skills +in containerization and deployment. Additionally, the workshop will +explore automation techniques for building container images and +introduce hosting options available via the CISL On-premise Cloud +Pilot, empowering participants to leverage cloud infrastructure for +their projects. Here is a [link to the code +repository](https://github.com/NicholasCote/nbviz-to-container) +containing a notebook that walks through the workshop content. + +## Who should attend? + +All UCAR staff interested in creating containers to host Python based +interactive visualizations as web servers. + + + +[Code of Conduct](https://www.ucar.edu/who-we-are/ethics-integrity/codes-conduct/participants) diff --git a/blog/2024/index.html b/blog/2024/index.html index 26019db0a..8352caf1a 100644 --- a/blog/2024/index.html +++ b/blog/2024/index.html @@ -515,6 +515,69 @@

+
+

+ Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations +

+ +

The ESDS Events Working Group is hosting a hybrid workshop on June 20th, from 9am until noon.

+

The event will be hosted at the Mesa Lab, located at 1850 Table +Mesa Dr, Boulder, CO 80305. In order to attend the event virtually, +registered participants will receive an email from Taysia +Peterson roughly one week prior to the event with Zoom details.

+

+ +

Read more ...

+
+
+

2024 ESDS Annual Event Recap diff --git a/blog/archive/index.html b/blog/archive/index.html index 0c7fe5b0c..f1c9838eb 100644 --- a/blog/archive/index.html +++ b/blog/archive/index.html @@ -512,6 +512,18 @@

+
+

+ + 07 May 2024 + + - + Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations +

+
+

diff --git a/blog/atom.xml b/blog/atom.xml index c2f70f7b3..7d5ce70f4 100644 --- a/blog/atom.xml +++ b/blog/atom.xml @@ -2,10 +2,32 @@ ncar.github.io/esds/ ESDS - 2024-05-06T17:35:29.269881+00:00 + 2024-05-14T15:48:23.712627+00:00 ABlog + + ncar.github.io/esds/posts/2024/containerize-visualizations-event/ + Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations + 2024-05-07T00:00:00+00:00 + + John Clyne + + <p class="ablog-post-excerpt"><p>The <a class="reference external" href="https://ncar.github.io/esds/about/#events-working-group">ESDS Events Working Group</a> is hosting a hybrid workshop on June 20th, from 9am until noon.</p> +<p>The event will be hosted at the Mesa Lab, located at 1850 Table +Mesa Dr, Boulder, CO 80305. In order to attend the event virtually, +registered participants will receive an email from Taysia +Peterson roughly one week prior to the event with Zoom details.</p> +</p> + + +

The ESDS Events Working Group is hosting a hybrid workshop on June 20th, from 9am until noon.The event will be hosted at the Mesa Lab, located at 1850 Table +Mesa Dr, Boulder, CO 80305. In order to attend the event virtually, +registered participants will receive an email from Taysia +Peterson roughly one week prior to the event with Zoom details. + + 2024-05-07T00:00:00+00:00 + ncar.github.io/esds/posts/2024/esds-annual-event-recap/ 2024 ESDS Annual Event Recap diff --git a/blog/author/index.html b/blog/author/index.html index 84951357f..a5a014a25 100644 --- a/blog/author/index.html +++ b/blog/author/index.html @@ -774,6 +774,29 @@

+
+

+ Posts by + John Clyne + +

+ +
+

+ + 07 May 2024 + + - + Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations +

+
+ +
+ + +

Posts by diff --git a/blog/author/john-clyne/index.html b/blog/author/john-clyne/index.html new file mode 100644 index 000000000..4cebb1b4b --- /dev/null +++ b/blog/author/john-clyne/index.html @@ -0,0 +1,656 @@ + + + + + + + + + + Posts by John Clyne — ESDS 0.1 documentation + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
+ + + + + + + + + + +
+
+
+
+ + + Ctrl+K +
+
+ +
+
+ + + +
+ +
+ + + +
+ +
+ +
+ +
+ +
+
+ +
+ + +
+ +
+ + + +
+ + +
+
+ + + Ctrl+K +
+ +
+ +
+ +
+ + +
+ + +
+ + + +
+ +
+ + +
+
+ + + + + +
+ + + +
+ + +
+ +
+
+ +
+ + + +
+ +
+
+ + + Ctrl+K +
+ +
+ +
+ +
+ + +
+
+ + + + +
+ +
+ + +
+
+ +
+
+ +
+ +
+ + + + +
+ +
+ + +
+
+ + + + + +
+ + +
+

+ + Posts by + + John Clyne + + +

+ + +
+

+ Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations +

+ +

The ESDS Events Working Group is hosting a hybrid workshop on June 20th, from 9am until noon.

+

The event will be hosted at the Mesa Lab, located at 1850 Table +Mesa Dr, Boulder, CO 80305. In order to attend the event virtually, +registered participants will receive an email from Taysia +Peterson roughly one week prior to the event with Zoom details.

+

+ +

Read more ...

+
+
+ + +
+ +
+ + + + + +
+ +
+
+
+ +
+ + + +
+ + +
+
+ +
+ +
+
+
+ + + + + +
+
+ +
+ +
+ +

+ + © Copyright 2024, Earth System Data Science (ESDS) Team. +
+ +

+
+ +
+ +

+ Created using Sphinx 7.3.7. +
+

+
+ +
+ + + +
+ +
+

+ Built with the PyData Sphinx Theme 0.15.2. +

+ +
+ +
+ +
+ + \ No newline at end of file diff --git a/blog/index.html b/blog/index.html index 39b63b15d..e4f64fd8e 100644 --- a/blog/index.html +++ b/blog/index.html @@ -904,7 +904,7 @@

  • - 2024 (1) + 2024 (2)
    • @@ -1004,6 +1004,69 @@

    +
    +

    + Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations +

    + +

    The ESDS Events Working Group is hosting a hybrid workshop on June 20th, from 9am until noon.

    +

    The event will be hosted at the Mesa Lab, located at 1850 Table +Mesa Dr, Boulder, CO 80305. In order to attend the event virtually, +registered participants will receive an email from Taysia +Peterson roughly one week prior to the event with Zoom details.

    +

    + +

    Read more ...

    +
    +
    +

    2024 ESDS Annual Event Recap diff --git a/blog/tag/tutorial-hackathon-events/index.html b/blog/tag/tutorial-hackathon-events/index.html index b54060b22..79d1bbb49 100644 --- a/blog/tag/tutorial-hackathon-events/index.html +++ b/blog/tag/tutorial-hackathon-events/index.html @@ -515,6 +515,69 @@

    +
    +

    + Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations +

    + +

    The ESDS Events Working Group is hosting a hybrid workshop on June 20th, from 9am until noon.

    +

    The event will be hosted at the Mesa Lab, located at 1850 Table +Mesa Dr, Boulder, CO 80305. In order to attend the event virtually, +registered participants will receive an email from Taysia +Peterson roughly one week prior to the event with Zoom details.

    +

    + +

    Read more ...

    +
    +
    +

    2024 ESDS Annual Event Recap diff --git a/index.html b/index.html index 459877992..e4326e321 100644 --- a/index.html +++ b/index.html @@ -502,6 +502,13 @@

    Earth System Data Science (ESDS) Initiative

    Recent posts#

      +

    • 2024-05-07 - Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations

      +

      The ESDS Events Working Group is hosting a hybrid workshop on June 20th, from 9am until noon.

      +

      The event will be hosted at the Mesa Lab, located at 1850 Table +Mesa Dr, Boulder, CO 80305. In order to attend the event virtually, +registered participants will receive an email from Taysia +Peterson roughly one week prior to the event with Zoom details.

      +

    • 2024-03-01 - 2024 ESDS Annual Event Recap

      The ESDS Events Working Group hosted the 2024 ESDS Annual Event January 18-19th in a hybrid format at the NSF NCAR diff --git a/objects.inv b/objects.inv index 82bf71c2351377b209734877a8df2dde051cb77d..5d7cef9f5d4d85eaefe6455a52a7d626cbfa12c2 100644 GIT binary patch delta 4076 zcmV$t@G%=!|G*J^7u>Cr>>3IJcmOE%~H zL8$4>Y0ipGlBU+__wE5Td4t5{rX?mnR{0)`h|(v4goLn^3TjW;ET4L|BG*8ujSpV&lI*;~;3ZARiM^ z(KM02Cx2&G;q-!BS7i?7nPlW=EWpZb6o;)}Sh7*4-eyV4jgygc|o55j6N=`npIhnFz%Zk_1Y1f_Ng4vTE;UlMby)(tm~W z187Px(;@6h0(*j@<5{9b;*L9M-J9}fOe_R=lnm_6xd~3A0VRsX?J*kRftNxqa)De! ziQr*knp-!Yh5jHN!(d$kYFnCeSZh5Q}6}20sIVS!uagP1s6gp7~QKsZgjO=)7R0f zoi{l_80tK`MoXA7rybP_9q42f^W18v{SCqCmTl&&kWSET1||+vO z2;y>bXi(S5RuM!$Kc=~j0oZHbv5@8V5XOfgCE3*1pay0H1x#fB-34&E#L`J&N62Hp@oZQ&xkr7)B8l!-AVj7%mS z{x0O*;9Sv?k2Nj1tTK5(QF(dSdR_BWMe$xS`WU0!sW3xHCT}cSkAH*7LX%o=(Ta6- z+EB-NRM;3$ye6VG)ta8qg<4KnP28U_Iiilx9a79((umbB7}r_3;UZtdtjBN?EugFV z0xLJ?^&IXB+uFkW6HzNSi#JLBY9>Rj5sh@xZkVi%y@oHO1HWZd##nHho?N}ZdDV!7 zLAmduJvw!BZ?H4mtAB&R{HAUX;hYLERn0O&a6$#zi&fY-tBL`V4P6cG>uz1}YPFV5 z;a*7P@Sn|X<|5`oo)xWz2L!0`87`$d)TqZ06KbRJ%d=mC2f7a#9I0u0epp2eNt?Sa z92>M)F>;X!aE8#uEz1v~hKz$QlNDUc)k*UcTznXu)#>-(gMVNC%em#6TW+}Fn^)G@ zxkH6oeN2iH16H~MKfFS(FR#N_*H^EIL=#w9gJTVAu%Y=3g4Oszj5>-Tsl;;m4o_BG z)JF-9et)2o=KYZsU;?0(yo=^MrHA=BJ%=e`=>pU!5q3UpbYWGdN0U8m4ENxv;dp@6}W;drbYN0pF><) zjYlFz>h|*YW8DyB)doiGvhJ2bGFKbTV5Ci}_EB^0lGT0bSSO$V#^N%BAFzxF_+#8o zHyf`sfe$mvyq0w2x~5Z?14XB4vRo!HgJ7j9I;gk)JtEig7o0TktHTn~Jm=sA(Hw+1)PI1>)B7i92ZB0&?TTEpG`DWr0cCqP>d2T@AfzY*&OL4{I+6Fp<}?8-pJ|IT z+uGwsBelH6$cByx1ulP_LU^@cASZ*+V|)-jI@LFR(p0XgU;aDVv5*!ld|a@tZWU&V zhxMOp;JZ)LZbJjftj^~CY zZ3zhwe*N-CNsv}XB8Zcpx3nEoX@>@(T#~_gUZ)Q%+L)=M!z@fy1H$sqpi9~ni5y1b zw12{kmGNR(W3Neu6HC*Sr7HEQoSD4*w|9Y|Lf_UY>>$NY8h!%&lk-cNXcKrbY50}L zRQ%G@BY!ZK^EYa3s}Jz64)97|TVy-3-L72s(P?3ec+Z^jlQYU{of?4ug?7z&QRf4@ z%Vtcb4%Hr{Qiq9Dd#=>lXE&pIOg`0~GJmxR>m^p7FRkjGDs^dQ&#yYOt0O5ii$r6# z%{SL(OMNdQSQw}RVXjwV;fPehxL)QA!xQog z9+`u2ZMumDW17J?ci}R zs31RE1S!oJiHH+8B_ygduECHLg(h%PO?b9sg{-5p z<1vCS%N=G%;-nlDxx468Lgf7hb5jk-IIW4uq$biO?Z7cXoEr+&B!M+qr&Go13?ICvNjkNv~8yskTVNfUC@S3z|v`F_Mg#(1HU{^mLUbhVuG85y4r6}M~O2MjV z8dr7Fq%L_rtEu%@ZygPIRfNl=z{g26egM+YH&N!x9FhM39mIwOzIak}?sS^@9iLGN z%acE^2Y*j_xMoqp|9|1z6P~@f9$i`V89vT>($g&G(-Dhk!y6O77bd2M6E+#`!wRow z74|xOOaJ|9{Xex<-%*V}uAVB||8q+A?N#|My|mi>XRX|~R%Ka~>6LEv3%7jgN-RCw z>rlL^P_&)|7!_>Oo6Ea!WJ4P$A(oIIi9Fd<9!tKCLx?EFUw`sOiqGM4p5faXt-sp4 ztqNY{^L@A#VFPZb30#?Z%2&1n*M~Lg_#({Z^J3tQYTz98BXFJQJEs%rU!;4nXwtT; zfM*y6%kcM>!Ic(+&UGSW5{wmE$-v;?TmK-I=56OyiSxjgwPLuXStP7x+tc3BfkK6CD7OrwnY(G^O+KrKMjx zL+z1X8?x^cNx}>HW<)-V?UibIJg7D5qx=1$3(+tZ?pZJm z`4G{KYN+P!!B~H5ArTn=p%U0pB3z%*ol0Tbg~Rm!aG35FI0Vym!d;T**?UuzXBMKB z<+*F|j*@mdBJDId5?(SIgg?M!(8dWdjp9lseVoWr_rI3-CTz(MP%>#a4k>|}-k_2d zNivHzV1G$cnj1~h{er2^x$z85b#vD@2)IwdUA4okzCrA%+HN463(P>3aU27vs{TK9 z#=t6Dq-?4aH^s_0S4T$6#}vAnwzqGoE6%_X#jdUjSECx18dnr+sd60&1WbnH2nCuK z<;MgA{lf8q$X@9<{{ISk@wgA5X|m5TNK<*sr)7Ye&rmLGTHS9f7{+<~wvu7*i==6% zdR-;u|MK(1%cKcEHm!RfK?a$94A}x4J9^WhW4Q^Q0X%jf#wJZHn6Z3Rdn{^v1XOHP e#Sbh7)jZ+iE;?W`uLC|%dzoVpg8u`vFT|e{Rp?9r delta 4010 zcmV;b4^{BSAcP>0fPb|!VcFQd%v|3b*-p~dv1{2$?@0quki?iGSb~(SKILz8=I+ns zm)tHuQXmO{kmJ7CCb7USfyM4(zlA5)@9%Eky}rMD_x=qL<>JQ$k4gBFOtkkAxtN|$ z$?KG_$b@HQk<6=-7lOR0k_8LiWhE=!-{2Q~8{Dmv>>B(IT}+_c2xrz+or5|Q^!Cx5k6H%+Ht4tlZP&_b^8IuRiE zJ}hDO1uGIz#3U=}1G7$yUw0{*MoDg1vE;?3S?#x~BiV}YN%s5&`3M{@fHG2MiMg*2n-UL?Zud8bj2PA)e7{Re&o%@*WC zA}X3D@_%`9b`?%9$aPibpq@!aZuaGxXAQH0t%_u^KuX(M4=9o0?V(>K*Ypu=!=>a- zGr}HW?&KC^$!c8+vV=(kmPN_){kUTH36bGMy*nszOa-XRET4!Of>t0HH zj=gwBO4#Y|*$y}$A-Q=y1~=j~WZh8-^+#G2`~MY=zS8VOy4&TtccfD_F&gcN2kNY|J)2CcfAxs+h5H@;j&CpUM+%{ zZ+|vb24=Vf!Sub;X^6o6X^$_+6=OL4;)R?~@L#+ta0j9mgbOyWR`9bdShldL{*V;E z;v8SB@JpoP;S?`Zz7sz}izI?3#YI$`O;UzvZRpPG&0a<(V#x`|hec6d9kgXCX$W>A zcQs-CMWef_L)DJn?x#+3SmmJ1%x|okcz-Y?xxYC-ySq3i_;VU8+G(>+cSC_geO%L$ zy!-O`Plz*8MvDwSU-{maEMW1f^0;FhJQMy zxrOf!k%j)i9ivH|1MD1VSA1IMWt`Q90>^qkIlB!fZ_d?tcYK$Tw-h|PBvO3yg5_3K z=+Q}g3cqQgi~#s)LdiF`>|0o!f-k_D;_H%o%wAk@A*6uOz4~#Zi{+ZWj$G}$$qB-U z;n^ix!jw7ns21ozCxe0K7DMfCh=1|6Y%^zt^d)XJF!eyuq&D0u+w#6{l-8`nh{q*A zijUr*&*oaS4Y>%Gmq&h2w@b?jLfcgVu`RjY0wZ)>Hxz=tO9(2i;7GO>!IJ*2J1%&P z$YsHPuVBg2JvkE(VBLPLAXJ3a62XdPNw#2*U7?z{5ttm z2s$QbcOm%B{NM{}V&6ga@!F_II(Id?HZV9i@WvthURQGu24;FGIQT(y?C|?-HP=`a zG+%F%KW1ZIpid|xqJmK=eG@`Ub0ctb*KPo#m5Fi#A~-Bky|ClE>|K_W3B}WMppGG7 z8#Jv_2=_*vm$TO)$kN1x&3~`X2TVzH@Lu6B7mXA$euW5Z3+Kr#g_)eEOpFO(>|~PR zpF)P%=ZcnmsA4kim#YQ04**2QT< z9jB?VbwKtSi&j-@dOjCwIbk(%f5PO5I?#1+G53;6te)Vz&dLoJ`F|Q_JqAm(fT8Mh zpxm6-a|pS&wTAa6q84rzZ<74gOom(|66vJfFj@QdItw5j_${L{#)3oX126qf-aqCIy9ib?`BtRK_8kQvs@~X+{W6s6c(OG8^xzVt`~rS3~`}TNk`qt))}A z7g9LFCN*vChn2;Uv^g?@ z*`URWk&8@#GlU^-S$+sLWE^yvtl)I3EX~hw@L^!9)9=6szx-*i`4qa5|F z23pI|!G@Ljel{}VNz^5igR$~P%i3&~^?Fzrx1~^7*gBV6*851VD-zV%)L?^VZ3gbQ z+CVHNr+8NH4u8~t`?tIMb%Ft9I?r|5T8n?uIH4LJ&Wb3QA%@HMVbc)dxE1J~ism*| zS|*@dGub#(IyHOb)bS10F3RJ;OPQe4^G%qxtM`HoRQV391?c2&&@0GdT7;kY9OBYy zJQ6Wdw}-!<>V_bzHt^Lh?QSV#=W3%VjMQn>KB~@LvVVFkJ!Qz}pIBUm@Bqt*d2@{0 z>1N}VZTIPnJg+4kxvuHd;Xu)8k}Q`=%ph2)ica!ae;<)+`2>~*o;qDZn&%w6AgZIV zZboYlIW^$&^zq5rfuN3GyDZl%&8?euK-r#+Iy|NoFe%D_bB_~?PUJnYIZZ&zXWHV- zw)VKuNPjI)F|whbOd-5lFyNCx=rR5gJvucuzS2alsbBs(+Od!pEPPzBt*#Yj ziimt<1Rlt5@bI^whhdreH}IAn+|np>i4zO&QfNLw6s$`-Bj*mf?v%le&YE z7YSjWi;|ppF+Dw&>8X?Hsm>HOQl3gb5+))m!+%eeC_{)3!X2B#;c3fKp0lnMIKDS5 zX-i0e@XO~vOMc*ntZ#K*EDv55e%oFGhd_3u7bZU`8D5pn`ks!?14PVH{Ji@v$HfR{X(% zFxXi1frw*a2w!x-!rzT39E&G-q6BVP%)r7x6bN&@fQ2KVf^oUb2*VTb1rOw4Tz{G_ z&|riae6a&JGYj7EOlX4>O>hduj&{(IUatMf z%(;b$SJK@xGi=T*+ZgM~=c5_ev(Q6M<{Y#~2HKirwleCbqOFN&q%F9dcuasMbj&+h zs3VkKPTY-bfL&2Q#41l2*xq5-%d~bAjG@Re!f=H|{sRnCx80;A3CUDa4}VTxsstV* zp*E5Ub5Im~YZ1%UCDNPu2aOHkA9isgv68WKiru>JA&Qi1jm zJM)HH|E3ClXnkN%mTq`V+A~_D`;dYGp)1(ckB3WQLxIf1cwi|CFn>xZXcbN4ss>H! zlIOFUTE9Hjk$_i4xJ(MX<3r;IAPs$iGT+V-`47-RY*^sMAw}ng)6Cc5j6zs$&UxLN zd&>PUixB?z$DVL|%yoCkBG2%S)01vEIj@dbSR3w`_}wruU7WD-XfIZHU8}Iy;akS< zSL^?!wfc@~{BiMA(SQD5Q?hTb%6G}7)$TuQ<-WBl%OXs#bgN&u@r?!_WW+pYqhVHhmK z-&+PpS`0eZiI5-|E3}e~z-)!F7N*_e*{77wnu;|o%nrqz9;KYF zdNRxS!@4s^)qk1RPo6bSPA#L>t@T*oFV!Ig+w?*71dy~cur zq;-_o);6wFX=@AEP5%zU6rbZKn8I;)Nt@^BO;MYfiGNns=B{NsireW3x6|Or^o&s< z{1Y?=X`CsV(Y%aF9%p8z`yURzDmUYokTFR(o{|AEy^}K5OpKYeAr~XLxwA34T{YDS zHvcM-cM!X&wi^hC0&}9r_#J~(PyMf5#*#g@NYhkjZHhH0)p;z&)3v}}0)hLQzvK2)0Ot*GV*CzEk QoUdyybIb|*|Hi>M#~wz

    @@ -591,7 +591,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2020/Time/index.html b/posts/2020/Time/index.html index 1ff8d34db..66ddfd1fc 100644 --- a/posts/2020/Time/index.html +++ b/posts/2020/Time/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2020/python-tutorial-faq-part-2/index.html b/posts/2020/python-tutorial-faq-part-2/index.html index 294c2169d..b8d8fa863 100644 --- a/posts/2020/python-tutorial-faq-part-2/index.html +++ b/posts/2020/python-tutorial-faq-part-2/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2020/python-tutorial-faq-part-3/index.html b/posts/2020/python-tutorial-faq-part-3/index.html index 60a4e13a8..0157d1086 100644 --- a/posts/2020/python-tutorial-faq-part-3/index.html +++ b/posts/2020/python-tutorial-faq-part-3/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2020/python-tutorial-faq/index.html b/posts/2020/python-tutorial-faq/index.html index a841495b6..b2ebf9eba 100644 --- a/posts/2020/python-tutorial-faq/index.html +++ b/posts/2020/python-tutorial-faq/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2020/templating-isnt-just-for-web-developers/index.html b/posts/2020/templating-isnt-just-for-web-developers/index.html index 7a65fbdea..0e45ee89c 100644 --- a/posts/2020/templating-isnt-just-for-web-developers/index.html +++ b/posts/2020/templating-isnt-just-for-web-developers/index.html @@ -548,6 +548,12 @@

    @@ -591,7 +591,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2020/tutorial-seminar-series/index.html b/posts/2020/tutorial-seminar-series/index.html index ab99acd0d..aa27c8632 100644 --- a/posts/2020/tutorial-seminar-series/index.html +++ b/posts/2020/tutorial-seminar-series/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2020/writing-multiple-netcdf-files-in-parallel-with-xarray-and-dask/index.html b/posts/2020/writing-multiple-netcdf-files-in-parallel-with-xarray-and-dask/index.html index c63f9a210..b1f00f9f0 100644 --- a/posts/2020/writing-multiple-netcdf-files-in-parallel-with-xarray-and-dask/index.html +++ b/posts/2020/writing-multiple-netcdf-files-in-parallel-with-xarray-and-dask/index.html @@ -560,6 +560,12 @@

    @@ -603,7 +603,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/Interactive_Dashboard/index.html b/posts/2021/Interactive_Dashboard/index.html index 9543d3f53..bd71cba18 100644 --- a/posts/2021/Interactive_Dashboard/index.html +++ b/posts/2021/Interactive_Dashboard/index.html @@ -548,6 +548,12 @@

    @@ -591,7 +591,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/advanced-plotting-tutorial/index.html b/posts/2021/advanced-plotting-tutorial/index.html index c95cc3d45..1fc3a10df 100644 --- a/posts/2021/advanced-plotting-tutorial/index.html +++ b/posts/2021/advanced-plotting-tutorial/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/benchmarking-history-timeseries-intake/index.html b/posts/2021/benchmarking-history-timeseries-intake/index.html index b9d9680a6..9e1f896ae 100644 --- a/posts/2021/benchmarking-history-timeseries-intake/index.html +++ b/posts/2021/benchmarking-history-timeseries-intake/index.html @@ -566,6 +566,12 @@

    @@ -609,7 +609,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/cartopy-tutorial/index.html b/posts/2021/cartopy-tutorial/index.html index e78d32d35..488224292 100644 --- a/posts/2021/cartopy-tutorial/index.html +++ b/posts/2021/cartopy-tutorial/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/casper_pbs_dask/index.html b/posts/2021/casper_pbs_dask/index.html index b0dd7d11e..beecd895f 100644 --- a/posts/2021/casper_pbs_dask/index.html +++ b/posts/2021/casper_pbs_dask/index.html @@ -548,6 +548,12 @@

    @@ -591,7 +591,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/cesm-datashader/index.html b/posts/2021/cesm-datashader/index.html index 54bd6f532..032b26b74 100644 --- a/posts/2021/cesm-datashader/index.html +++ b/posts/2021/cesm-datashader/index.html @@ -556,6 +556,12 @@

    @@ -599,7 +599,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/cesm-workshop-2021-diagnostics/index.html b/posts/2021/cesm-workshop-2021-diagnostics/index.html index eb392a443..7ecca7d6d 100644 --- a/posts/2021/cesm-workshop-2021-diagnostics/index.html +++ b/posts/2021/cesm-workshop-2021-diagnostics/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/dask-summit-takeaway/index.html b/posts/2021/dask-summit-takeaway/index.html index e1f78fe22..fec2ccefd 100644 --- a/posts/2021/dask-summit-takeaway/index.html +++ b/posts/2021/dask-summit-takeaway/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/dask-tutorial-update/index.html b/posts/2021/dask-tutorial-update/index.html index fafedf9b1..2a63a93bd 100644 --- a/posts/2021/dask-tutorial-update/index.html +++ b/posts/2021/dask-tutorial-update/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/dask-tutorial/index.html b/posts/2021/dask-tutorial/index.html index b2d2791d8..5275d49df 100644 --- a/posts/2021/dask-tutorial/index.html +++ b/posts/2021/dask-tutorial/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/ecgtools-history-files-example/index.html b/posts/2021/ecgtools-history-files-example/index.html index fbb2e17ad..bad29f812 100644 --- a/posts/2021/ecgtools-history-files-example/index.html +++ b/posts/2021/ecgtools-history-files-example/index.html @@ -548,6 +548,12 @@

    @@ -591,7 +591,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/esds-blog/index.html b/posts/2021/esds-blog/index.html index 871282146..67d05046e 100644 --- a/posts/2021/esds-blog/index.html +++ b/posts/2021/esds-blog/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/esds-update-november-2021/index.html b/posts/2021/esds-update-november-2021/index.html index 99dafc3ae..8237e8a77 100644 --- a/posts/2021/esds-update-november-2021/index.html +++ b/posts/2021/esds-update-november-2021/index.html @@ -566,6 +566,12 @@

    @@ -609,7 +609,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/esds-update-october-2021/index.html b/posts/2021/esds-update-october-2021/index.html index 9475fcf72..221ca674c 100644 --- a/posts/2021/esds-update-october-2021/index.html +++ b/posts/2021/esds-update-october-2021/index.html @@ -566,6 +566,12 @@

    @@ -609,7 +609,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/esds-update-september-2021/index.html b/posts/2021/esds-update-september-2021/index.html index 641124a36..56fbbb559 100644 --- a/posts/2021/esds-update-september-2021/index.html +++ b/posts/2021/esds-update-september-2021/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/geocat-comp-tutorial/index.html b/posts/2021/geocat-comp-tutorial/index.html index 20f992e19..ceda241eb 100644 --- a/posts/2021/geocat-comp-tutorial/index.html +++ b/posts/2021/geocat-comp-tutorial/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/geocat-tutorial/index.html b/posts/2021/geocat-tutorial/index.html index 0f4c3466f..88cfad808 100644 --- a/posts/2021/geocat-tutorial/index.html +++ b/posts/2021/geocat-tutorial/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/git-and-github-tutorial/index.html b/posts/2021/git-and-github-tutorial/index.html index 986db9bdd..892ecea7b 100644 --- a/posts/2021/git-and-github-tutorial/index.html +++ b/posts/2021/git-and-github-tutorial/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/graphviz_example/index.html b/posts/2021/graphviz_example/index.html index 300657b75..40dcf997b 100644 --- a/posts/2021/graphviz_example/index.html +++ b/posts/2021/graphviz_example/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/intake-cesm2-le-glade-example/index.html b/posts/2021/intake-cesm2-le-glade-example/index.html index a64fb032d..da136b4c1 100644 --- a/posts/2021/intake-cesm2-le-glade-example/index.html +++ b/posts/2021/intake-cesm2-le-glade-example/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/intake-esm-derived-variables/index.html b/posts/2021/intake-esm-derived-variables/index.html index ebf301423..34d47b995 100644 --- a/posts/2021/intake-esm-derived-variables/index.html +++ b/posts/2021/intake-esm-derived-variables/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/intake-esm-holoviews-diagnostics/index.html b/posts/2021/intake-esm-holoviews-diagnostics/index.html index d4fea2ede..a90957cbb 100644 --- a/posts/2021/intake-esm-holoviews-diagnostics/index.html +++ b/posts/2021/intake-esm-holoviews-diagnostics/index.html @@ -560,6 +560,12 @@

    @@ -603,7 +603,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/intake-esm-tutorial-2021/index.html b/posts/2021/intake-esm-tutorial-2021/index.html index 5919409db..fcaa75cbf 100644 --- a/posts/2021/intake-esm-tutorial-2021/index.html +++ b/posts/2021/intake-esm-tutorial-2021/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/intake-obs-cesm2le-comparison/index.html b/posts/2021/intake-obs-cesm2le-comparison/index.html index f51411d6e..6b08c190e 100644 --- a/posts/2021/intake-obs-cesm2le-comparison/index.html +++ b/posts/2021/intake-obs-cesm2le-comparison/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/intake_cmip6_debug/index.html b/posts/2021/intake_cmip6_debug/index.html index f79479716..670155bbf 100644 --- a/posts/2021/intake_cmip6_debug/index.html +++ b/posts/2021/intake_cmip6_debug/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/intake_esm_dask/index.html b/posts/2021/intake_esm_dask/index.html index 96ef256a0..82f9566e0 100644 --- a/posts/2021/intake_esm_dask/index.html +++ b/posts/2021/intake_esm_dask/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/jupyter-based-diagnostics-overview/index.html b/posts/2021/jupyter-based-diagnostics-overview/index.html index 4d0017fea..83e0884cd 100644 --- a/posts/2021/jupyter-based-diagnostics-overview/index.html +++ b/posts/2021/jupyter-based-diagnostics-overview/index.html @@ -566,6 +566,12 @@

    @@ -609,7 +609,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/jupyter-notebooks-faq/index.html b/posts/2021/jupyter-notebooks-faq/index.html index 0e6b8e266..b02e573be 100644 --- a/posts/2021/jupyter-notebooks-faq/index.html +++ b/posts/2021/jupyter-notebooks-faq/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/kay-et-al-cesm2-le/index.html b/posts/2021/kay-et-al-cesm2-le/index.html index f009d0d30..88ed9a2c2 100644 --- a/posts/2021/kay-et-al-cesm2-le/index.html +++ b/posts/2021/kay-et-al-cesm2-le/index.html @@ -566,6 +566,12 @@

    @@ -609,7 +609,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/map_blocks_example/index.html b/posts/2021/map_blocks_example/index.html index 23b26ac63..f200bae62 100644 --- a/posts/2021/map_blocks_example/index.html +++ b/posts/2021/map_blocks_example/index.html @@ -561,6 +561,12 @@

    @@ -604,7 +604,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/matplotlib-faq/index.html b/posts/2021/matplotlib-faq/index.html index 08cd9e022..9d760320b 100644 --- a/posts/2021/matplotlib-faq/index.html +++ b/posts/2021/matplotlib-faq/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/matplotlib-tutorial/index.html b/posts/2021/matplotlib-tutorial/index.html index 0a280b3b0..da658644d 100644 --- a/posts/2021/matplotlib-tutorial/index.html +++ b/posts/2021/matplotlib-tutorial/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/model_documentation_jupyterbook/index.html b/posts/2021/model_documentation_jupyterbook/index.html index fdef05d0a..cbc973864 100644 --- a/posts/2021/model_documentation_jupyterbook/index.html +++ b/posts/2021/model_documentation_jupyterbook/index.html @@ -560,6 +560,12 @@

    @@ -603,7 +603,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/multiple_index_xarray_xoak/index.html b/posts/2021/multiple_index_xarray_xoak/index.html index 76321e897..f6143b232 100644 --- a/posts/2021/multiple_index_xarray_xoak/index.html +++ b/posts/2021/multiple_index_xarray_xoak/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/ncar-jobqueue-example/index.html b/posts/2021/ncar-jobqueue-example/index.html index b756b26b6..8f912ab22 100644 --- a/posts/2021/ncar-jobqueue-example/index.html +++ b/posts/2021/ncar-jobqueue-example/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/numpy-faq/index.html b/posts/2021/numpy-faq/index.html index 8fda5aa39..c0332a157 100644 --- a/posts/2021/numpy-faq/index.html +++ b/posts/2021/numpy-faq/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/numpy-tutorial/index.html b/posts/2021/numpy-tutorial/index.html index 87338b817..b3538d43c 100644 --- a/posts/2021/numpy-tutorial/index.html +++ b/posts/2021/numpy-tutorial/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/object-oriented-programming-tutorial/index.html b/posts/2021/object-oriented-programming-tutorial/index.html index 34b0266b7..a3e6f6c21 100644 --- a/posts/2021/object-oriented-programming-tutorial/index.html +++ b/posts/2021/object-oriented-programming-tutorial/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/oop-tutorial/index.html b/posts/2021/oop-tutorial/index.html index 53fb3511e..c2d175789 100644 --- a/posts/2021/oop-tutorial/index.html +++ b/posts/2021/oop-tutorial/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/paired_programming_vs/index.html b/posts/2021/paired_programming_vs/index.html index 946a1c07e..114cd7b0c 100644 --- a/posts/2021/paired_programming_vs/index.html +++ b/posts/2021/paired_programming_vs/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/pandas-tutorial/index.html b/posts/2021/pandas-tutorial/index.html index 0313406c6..9f5a0fcff 100644 --- a/posts/2021/pandas-tutorial/index.html +++ b/posts/2021/pandas-tutorial/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/project-pythia-overview/index.html b/posts/2021/project-pythia-overview/index.html index f8f6127ea..fe3c9f37c 100644 --- a/posts/2021/project-pythia-overview/index.html +++ b/posts/2021/project-pythia-overview/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/python-tutorial-seminar-series-spring-2021/index.html b/posts/2021/python-tutorial-seminar-series-spring-2021/index.html index 7414ebbbe..af52794e8 100644 --- a/posts/2021/python-tutorial-seminar-series-spring-2021/index.html +++ b/posts/2021/python-tutorial-seminar-series-spring-2021/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/regrid-observations-pop-grid/index.html b/posts/2021/regrid-observations-pop-grid/index.html index 7493cca45..89555d104 100644 --- a/posts/2021/regrid-observations-pop-grid/index.html +++ b/posts/2021/regrid-observations-pop-grid/index.html @@ -560,6 +560,12 @@

    @@ -603,7 +603,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/scaling-with-dask-class-takeaways/index.html b/posts/2021/scaling-with-dask-class-takeaways/index.html index 518395e36..7640e9622 100644 --- a/posts/2021/scaling-with-dask-class-takeaways/index.html +++ b/posts/2021/scaling-with-dask-class-takeaways/index.html @@ -548,6 +548,12 @@

    @@ -591,7 +591,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/scipy-2021-takeaways/index.html b/posts/2021/scipy-2021-takeaways/index.html index ab45c9ae6..a96360c52 100644 --- a/posts/2021/scipy-2021-takeaways/index.html +++ b/posts/2021/scipy-2021-takeaways/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/software-citation/index.html b/posts/2021/software-citation/index.html index 683c2f438..1e3297add 100644 --- a/posts/2021/software-citation/index.html +++ b/posts/2021/software-citation/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/weather-station-data-preprocess/index.html b/posts/2021/weather-station-data-preprocess/index.html index ad43adaa6..7f7780da6 100644 --- a/posts/2021/weather-station-data-preprocess/index.html +++ b/posts/2021/weather-station-data-preprocess/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/xarray-tutorial/index.html b/posts/2021/xarray-tutorial/index.html index 74e2bb995..bb4363849 100644 --- a/posts/2021/xarray-tutorial/index.html +++ b/posts/2021/xarray-tutorial/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/xarray-wrf-example/index.html b/posts/2021/xarray-wrf-example/index.html index 6584d8e3f..0d06465fc 100644 --- a/posts/2021/xarray-wrf-example/index.html +++ b/posts/2021/xarray-wrf-example/index.html @@ -561,6 +561,12 @@

    @@ -604,7 +604,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/yearly-averages-xarray/index.html b/posts/2021/yearly-averages-xarray/index.html index 34994d181..06109b3de 100644 --- a/posts/2021/yearly-averages-xarray/index.html +++ b/posts/2021/yearly-averages-xarray/index.html @@ -560,6 +560,12 @@

    @@ -603,7 +603,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2021/your-first-package-python-tutorial-faq/index.html b/posts/2021/your-first-package-python-tutorial-faq/index.html index f320fc07e..e76dc6eec 100644 --- a/posts/2021/your-first-package-python-tutorial-faq/index.html +++ b/posts/2021/your-first-package-python-tutorial-faq/index.html @@ -548,6 +548,12 @@

    @@ -591,7 +591,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2022/Thinking-with-Xarray/index.html b/posts/2022/Thinking-with-Xarray/index.html index 455c102ed..9d5306186 100644 --- a/posts/2022/Thinking-with-Xarray/index.html +++ b/posts/2022/Thinking-with-Xarray/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2022/batch-processing-notebooks-with-papermill/index.html b/posts/2022/batch-processing-notebooks-with-papermill/index.html index 85edb1d33..730f1562c 100644 --- a/posts/2022/batch-processing-notebooks-with-papermill/index.html +++ b/posts/2022/batch-processing-notebooks-with-papermill/index.html @@ -573,6 +573,12 @@

    @@ -616,7 +616,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2022/cam-se-regridding/index.html b/posts/2022/cam-se-regridding/index.html index d81372d9e..f4f7f1583 100644 --- a/posts/2022/cam-se-regridding/index.html +++ b/posts/2022/cam-se-regridding/index.html @@ -555,6 +555,12 @@

    @@ -598,7 +598,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2022/dask-debug-detrend/index.html b/posts/2022/dask-debug-detrend/index.html index 95bbf3c39..1b0bd227e 100644 --- a/posts/2022/dask-debug-detrend/index.html +++ b/posts/2022/dask-debug-detrend/index.html @@ -548,6 +548,12 @@

    @@ -591,7 +591,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2022/debugging/index.html b/posts/2022/debugging/index.html index ff9da25cb..2c7341470 100644 --- a/posts/2022/debugging/index.html +++ b/posts/2022/debugging/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2022/esds-event-prep/index.html b/posts/2022/esds-event-prep/index.html index 3c5ee227b..775ac6f96 100644 --- a/posts/2022/esds-event-prep/index.html +++ b/posts/2022/esds-event-prep/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2022/esds-event-recap/index.html b/posts/2022/esds-event-recap/index.html index d7833c083..daaa38aec 100644 --- a/posts/2022/esds-event-recap/index.html +++ b/posts/2022/esds-event-recap/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2022/esds-fall-event/index.html b/posts/2022/esds-fall-event/index.html index bba625dde..845a33671 100644 --- a/posts/2022/esds-fall-event/index.html +++ b/posts/2022/esds-fall-event/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2022/metpy_tutorial/index.html b/posts/2022/metpy_tutorial/index.html index 9754b4199..6b37f9da7 100644 --- a/posts/2022/metpy_tutorial/index.html +++ b/posts/2022/metpy_tutorial/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2022/office-hours-appointments/index.html b/posts/2022/office-hours-appointments/index.html index 8ca699a0a..7e91e9b17 100644 --- a/posts/2022/office-hours-appointments/index.html +++ b/posts/2022/office-hours-appointments/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2022/sparse-PFT-gridding/index.html b/posts/2022/sparse-PFT-gridding/index.html index d69e69534..59d589191 100644 --- a/posts/2022/sparse-PFT-gridding/index.html +++ b/posts/2022/sparse-PFT-gridding/index.html @@ -567,6 +567,12 @@

    @@ -610,7 +610,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2022/xarray-groupby-vs-geocat-climatology/index.html b/posts/2022/xarray-groupby-vs-geocat-climatology/index.html index 8b5df9fee..cfadc53bb 100644 --- a/posts/2022/xarray-groupby-vs-geocat-climatology/index.html +++ b/posts/2022/xarray-groupby-vs-geocat-climatology/index.html @@ -566,6 +566,12 @@

    @@ -609,7 +609,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2022/yourfirst/index.html b/posts/2022/yourfirst/index.html index 0667e1c25..c752e6df9 100644 --- a/posts/2022/yourfirst/index.html +++ b/posts/2022/yourfirst/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2023/cam-se-analysis/index.html b/posts/2023/cam-se-analysis/index.html index b1ada3727..f19110850 100644 --- a/posts/2023/cam-se-analysis/index.html +++ b/posts/2023/cam-se-analysis/index.html @@ -607,6 +607,12 @@

    @@ -650,7 +650,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2023/cesm2-le-timeseries-kerchunk/index.html b/posts/2023/cesm2-le-timeseries-kerchunk/index.html index 0e3843cc9..460481c93 100644 --- a/posts/2023/cesm2-le-timeseries-kerchunk/index.html +++ b/posts/2023/cesm2-le-timeseries-kerchunk/index.html @@ -567,6 +567,12 @@

    @@ -610,7 +610,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2023/esds-annual-event/index.html b/posts/2023/esds-annual-event/index.html index 1e13dbd20..288c7b69b 100644 --- a/posts/2023/esds-annual-event/index.html +++ b/posts/2023/esds-annual-event/index.html @@ -548,6 +548,12 @@

    @@ -591,7 +591,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2023/kerchunk-mom6/index.html b/posts/2023/kerchunk-mom6/index.html index 91bea8bad..bc6d91330 100644 --- a/posts/2023/kerchunk-mom6/index.html +++ b/posts/2023/kerchunk-mom6/index.html @@ -526,6 +526,12 @@

    @@ -569,7 +569,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2023/mfdataset/index.html b/posts/2023/mfdataset/index.html index baa97c2f2..aa2da7088 100644 --- a/posts/2023/mfdataset/index.html +++ b/posts/2023/mfdataset/index.html @@ -526,6 +526,12 @@

    @@ -569,7 +569,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2023/office-hours-help/index.html b/posts/2023/office-hours-help/index.html index 6bd721551..34ca3456f 100644 --- a/posts/2023/office-hours-help/index.html +++ b/posts/2023/office-hours-help/index.html @@ -541,6 +541,12 @@

    @@ -584,7 +584,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2023/scipy23/index.html b/posts/2023/scipy23/index.html index 229078c7f..bcdc639e8 100644 --- a/posts/2023/scipy23/index.html +++ b/posts/2023/scipy23/index.html @@ -554,6 +554,12 @@

    @@ -597,7 +597,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2023/unstructured-grid-collab-1/index.html b/posts/2023/unstructured-grid-collab-1/index.html index 55aa717d2..7a5dba98a 100644 --- a/posts/2023/unstructured-grid-collab-1/index.html +++ b/posts/2023/unstructured-grid-collab-1/index.html @@ -562,6 +562,12 @@

    @@ -605,7 +605,7 @@

  • - 2024 (1) + 2024 (2)
    • diff --git a/posts/2024/containerize-visualizations-event/index.html b/posts/2024/containerize-visualizations-event/index.html new file mode 100644 index 000000000..f6d8ae250 --- /dev/null +++ b/posts/2024/containerize-visualizations-event/index.html @@ -0,0 +1,833 @@ + + + + + + + + + + + Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations — ESDS 0.1 documentation + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + +
    + + + + + + + + + + +
    +
    +
    +
    + + + Ctrl+K +
    +
    + +
    +
    + + + +
    + +
    + + + +
    + +
    + +
    + +
    + +
    +
    + +
    + + +
    + +
    + + + +
    + + +
    +
    + + + Ctrl+K +
    + +
    + +
    + +
    + + +
    + + +
    + + + + + +
    + +
    + + +
    +
    + + + + + +
    + + + +
    + + +
    + +
    +
    + +
    + + + +
    + +
    +
    + + + Ctrl+K +
    + +
    + +
    + +
    + +
    +
    +
    + + + Ctrl+K +
    +
    + +
    + + +

    + + + + + 07 May 2024 + +

    + +
    +
    +
    + +
    +

    + Recent Posts +

    + +
    +
    +
    + +
    +

    + Archives +

    + +
    +
    +
    + + +
    +
    + + + + +
    + +
    + + +
    +
    + +
    +
    + +
    + +
    + + + + +
    + +
    + + +
    +
    + + + + + +
    + +
    +

    Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations#

    +

    The ESDS Events Working Group is hosting a hybrid workshop on June 20th, from 9am until noon.

    +

    The event will be hosted at the Mesa Lab, located at 1850 Table +Mesa Dr, Boulder, CO 80305. In order to attend the event virtually, +registered participants will receive an email from Taysia +Peterson roughly one week prior to the event with Zoom details.

    +
    +

    Registration#

    +

    Coming soon

    +
    +
    +

    What is it?#

    +

    This workshop guides participants through the process of transforming +an interactive visualization from a Jupyter Notebook into a +Python-based web server. Attendees will learn how to create and run +a containerized version of the web server, gaining practical skills +in containerization and deployment. Additionally, the workshop will +explore automation techniques for building container images and +introduce hosting options available via the CISL On-premise Cloud +Pilot, empowering participants to leverage cloud infrastructure for +their projects. Here is a link to the code +repository +containing a notebook that walks through the workshop content.

    +
    +
    +

    Who should attend?#

    +

    All UCAR staff interested in creating containers to host Python based +interactive visualizations as web servers.

    +

    Code of Conduct

    +
    +
    + +
    + + + + +
    + + + + + + + + 2024 ESDS Annual Event Recap + + + +   + + + +
    + + + +
    + +
    + + + + + +
    + +
    +
    +
    + +
    + + + +
    + + +
    +
    + On this page +
    +
    + +
    + +
    + + Show Source + +
    +
    + +
    + + +
    +
    + +
    + +
    +
    +
    + + + + + +
    +
    + +
    + +
    + +

    + + © Copyright 2024, Earth System Data Science (ESDS) Team. +
    + +

    +
    + +
    + +

    + Created using Sphinx 7.3.7. +
    +

    +
    + +
    + + + +
    + +
    +

    + Built with the PyData Sphinx Theme 0.15.2. +

    + +
    + +
    + +
    + + \ No newline at end of file diff --git a/posts/2024/esds-annual-event-recap/index.html b/posts/2024/esds-annual-event-recap/index.html index f95a1575a..74d8bbb59 100644 --- a/posts/2024/esds-annual-event-recap/index.html +++ b/posts/2024/esds-annual-event-recap/index.html @@ -548,6 +548,12 @@

    @@ -591,7 +591,7 @@

  • - 2024 (1) + 2024 (2)
    • @@ -754,6 +754,14 @@

    Acknowledgements  + + + Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations + + + + + diff --git a/searchindex.js b/searchindex.js index 9193a2667..5db5885bc 100644 --- a/searchindex.js +++ b/searchindex.js @@ -1 +1 @@ -Search.setIndex({"alltitles": {"1. Download VS Code": [[57, "download-vs-code"]], "1. Regrid CAM-SE output using map file": [[83, "regrid-cam-se-output-using-map-file"]], "2. Setup Remote Login": [[57, "setup-remote-login"]], "2. Use a CAM-SE remap function to scale up": [[83, "use-a-cam-se-remap-function-to-scale-up"]], "2024 ESDS Annual Event Recap": [[91, "esds-annual-event-recap"]], "2024 Earth System Data Science (ESDS) Annual Event": [[85, "earth-system-data-science-esds-annual-event"]], "3. Enable Sharing": [[57, "enable-sharing"]], "3. Regrid CAM-SE output using xESMF": [[83, "regrid-cam-se-output-using-xesmf"]], "4+1 Software Architecture Model": [[4, "software-architecture-model"]], "4. Direct sparse matrix multiply-add": [[83, "direct-sparse-matrix-multiply-add"]], "4. Setup Your Virtual Meeting": [[57, "setup-your-virtual-meeting"]], "5. Collaborate!": [[57, "collaborate"]], "A (Re)Introduction to Earth System Data Science (ESDS) Across NCAR/UCAR/UCP": [[77, "a-re-introduction-to-earth-system-data-science-esds-across-ncar-ucar-ucp"]], "A dask bug": [[73, "a-dask-bug"]], "About Us": [[2, "about-us"]], "Accessibility": [[3, "accessibility"]], "Accessing the Data (Plots)": [[18, "accessing-the-data-plots"]], "Acknowledgements": [[76, "acknowledgements"], [91, "acknowledgements"]], "Add Jupyterbook files": [[50, "add-jupyterbook-files"]], "Add a Helper Function to Make Sure the Colorbar is around 0": [[61, "add-a-helper-function-to-make-sure-the-colorbar-is-around-0"]], "Add print statements to your code": [[74, "add-print-statements-to-your-code"]], "Add to your Table of Contents (_toc.yml) file": [[50, "add-to-your-table-of-contents-toc-yml-file"]], "Adding the parsing function": [[41, "adding-the-parsing-function"]], "Adding to your Config (_config.yml) file": [[50, "adding-to-your-config-config-yml-file"]], "Additional Imports": [[28, "additional-imports"]], "Additional Info": [[81, "additional-info"]], "Advanced Plotting Tutorial": [[19, "advanced-plotting-tutorial"], [31, "advanced-plotting-tutorial"]], "Agenda": [[76, "agenda"]], "An Example of Using Intake-ESM": [[43, "an-example-of-using-intake-esm"]], "An older dask version": [[73, "an-older-dask-version"]], "Analysis Repository": [[4, "analysis-repository"]], "Analysis Workflow Special Interest Group (AWSIG)": [[6, "analysis-workflow-special-interest-group-awsig"]], "Analyzing and visualizing CAM-SE output in Python": [[83, "analyzing-and-visualizing-cam-se-output-in-python"]], "Appendix": [[20, "appendix"]], "Apply an Annual Mean Calculation": [[38, "apply-an-annual-mean-calculation"]], "Apply an operation": [[43, "apply-an-operation"]], "Apply our function": [[37, "apply-our-function"]], "Apply remap function onto first timestep of TS": [[83, "apply-remap-function-onto-first-timestep-of-ts"]], "Apply sparse map onto first timestep of TS": [[83, "apply-sparse-map-onto-first-timestep-of-ts"]], "Apply the Computation with History Files": [[20, "apply-the-computation-with-history-files"]], "Apply the Computation with Timeseries": [[20, "apply-the-computation-with-timeseries"]], "Apply the Regridder": [[72, "apply-the-regridder"]], "Apply the regridder": [[83, "apply-the-regridder"]], "Apply the search for data": [[43, "apply-the-search-for-data"]], "Apply this function to our dataset": [[23, "apply-this-function-to-our-dataset"]], "Apply to entire dask DataArray": [[80, "apply-to-entire-dask-dataarray"]], "Apply weights": [[83, "apply-weights"]], "Applying Mixed Layer Depth Calculation": [[47, "applying-mixed-layer-depth-calculation"]], "Applying our \u201cWorkaround\u201d": [[42, "applying-our-workaround"]], "Approach": [[84, "approach"]], "Aside: further compressing the vegtype dimension": [[80, "aside-further-compressing-the-vegtype-dimension"]], "Asking Questions": [[29, "asking-questions"]], "Assumptions of past Git experience": [[35, "assumptions-of-past-git-experience"]], "Atmosphere Diagnostics Framework (ADF)": [[92, "atmosphere-diagnostics-framework-adf"]], "Atmospheric data Community Toolkit": [[63, "atmospheric-data-community-toolkit"]], "Attempt 2": [[73, "attempt-2"]], "Automating the Book Build using Github Actions": [[44, "automating-the-book-build-using-github-actions"]], "Back to CLM output": [[80, "back-to-clm-output"]], "Background": [[63, "background"]], "Background and Motivation": [[71, "background-and-motivation"]], "Batch Processing Jupyter Notebooks with Papermill": [[71, "batch-processing-jupyter-notebooks-with-papermill"]], "Benchmark Reading in from Kerchunk mappings": [[84, "benchmark-reading-in-from-kerchunk-mappings"]], "Benchmarking Performance of History vs. Timeseries Files with ecgtools, Intake-ESM, and Dask": [[20, "benchmarking-performance-of-history-vs-timeseries-files-with-ecgtools-intake-esm-and-dask"]], "Best Practices": [[4, "best-practices"], [62, "best-practices"]], "Better (Open Source) Homes and Gardens with Project Pythia": [[89, "better-open-source-homes-and-gardens-with-project-pythia"]], "Binder": [[75, "binder"]], "Bio": [[40, "bio"], [56, "bio"], [70, "bio"], [78, "bio"], [82, "bio"]], "Blog": [[5, "blog"]], "Blog Posts": [[32, "blog-posts"]], "Breakout Group Materials": [[76, "breakout-group-materials"]], "Bringing These Two Together": [[20, "bringing-these-two-together"]], "Bringing automated data analysis and machine learning pipelines directly to end users using Unidata tools": [[89, "bringing-automated-data-analysis-and-machine-learning-pipelines-directly-to-end-users-using-unidata-tools"]], "Bringing it All Together": [[65, "bringing-it-all-together"]], "Build a parser using ecgtools": [[41, "build-a-parser-using-ecgtools"]], "Build an Intake-ESM catalog from the observational dataset": [[41, "build-an-intake-esm-catalog-from-the-observational-dataset"]], "Build data array with dimension and coordinates": [[83, "build-data-array-with-dimension-and-coordinates"]], "Build the Catalogs": [[20, "build-the-catalogs"]], "Build the Dashboard": [[18, "build-the-dashboard"]], "Build the History File Catalog": [[20, "build-the-history-file-catalog"]], "Build the Timeseries Catalog": [[20, "build-the-timeseries-catalog"]], "Build the book and push to your Github Pages branch": [[50, "build-the-book-and-push-to-your-github-pages-branch"]], "Build the catalog using the parse_cesm_history parser": [[20, "build-the-catalog-using-the-parse-cesm-history-parser"]], "Build the catalog using the parse_cesm_timeseries parser": [[20, "build-the-catalog-using-the-parse-cesm-timeseries-parser"]], "Build the catalog!": [[28, "build-the-catalog"]], "Build your Book!": [[50, "build-your-book"]], "Build your Catalog": [[50, "build-your-catalog"]], "Building MetPy for the Long Term: Working to Keep an Open Source Project Sustainable": [[89, "building-metpy-for-the-long-term-working-to-keep-an-open-source-project-sustainable"]], "Building a better polyval": [[73, "building-a-better-polyval"]], "Building an Intake-esm catalog from CESM2 History Files": [[28, "building-an-intake-esm-catalog-from-cesm2-history-files"]], "CESM Data": [[7, "cesm-data"]], "CESM Diagnostics Discussion": [[24, "cesm-diagnostics-discussion"]], "CESM MOM6 output": [[86, "cesm-mom6-output"]], "CESM Unified Postprocessing and Diagnostics (CUPiD)": [[92, "cesm-unified-postprocessing-and-diagnostics-cupid"]], "CESM2-Large Ensemble Reproduction of Kay et al. 2015": [[46, "cesm2-large-ensemble-reproduction-of-kay-et-al-2015"]], "Calculate an annual mean": [[43, "calculate-an-annual-mean"]], "Calculate the Annual Average Incorrectly": [[68, "calculate-the-annual-average-incorrectly"]], "Calculating Temporal Averages with GeoCAT-comp vs Xarray": [[81, "calculating-temporal-averages-with-geocat-comp-vs-xarray"]], "Calculating the New Time Axis": [[65, "calculating-the-new-time-axis"]], "Calculating the Yearly Average Correctly": [[68, "calculating-the-yearly-average-correctly"]], "Calendar So Far": [[16, "calendar-so-far"], [82, "calendar-so-far"]], "Calling to_dataset_dict to Load in the Data": [[38, "calling-to-dataset-dict-to-load-in-the-data"]], "Cartopy Tutorial": [[21, "cartopy-tutorial"]], "Cartopy Tutorial (26 April 2021)": [[32, "cartopy-tutorial-26-april-2021"]], "Celebrate when the error message changes": [[74, "celebrate-when-the-error-message-changes"]], "Challenges": [[81, "challenges"]], "Challenges of detrending": [[73, "challenges-of-detrending"]], "Change your mindset": [[74, "change-your-mindset"]], "Check the Codebase": [[74, "check-the-codebase"]], "Check the Documentation": [[74, "check-the-documentation"]], "Choosing a chunk size": [[87, "choosing-a-chunk-size"]], "Choosing combine options": [[87, "choosing-combine-options"]], "Chunking in space": [[83, "chunking-in-space"]], "Climate Model Evaluation Workflow Built on Jupyter Notebooks": [[89, "climate-model-evaluation-workflow-built-on-jupyter-notebooks"]], "Clone to your machine!": [[50, "clone-to-your-machine"]], "Clone your Repository": [[50, "clone-your-repository"]], "Cloud-optimized access to CESM Timeseries netCDF files in the Cloud with kerchunk": [[84, "cloud-optimized-access-to-cesm-timeseries-netcdf-files-in-the-cloud-with-kerchunk"]], "Collaborative Work Time": [[91, "collaborative-work-time"]], "Combine datasets to single Zarr with groups": [[86, "combine-datasets-to-single-zarr-with-groups"]], "Combine the datasets": [[43, "combine-the-datasets"]], "Comments on the Open Development Model": [[63, "comments-on-the-open-development-model"]], "Communication Platforms": [[6, "communication-platforms"]], "Communication, Meetings, and Resources": [[6, "communication-meetings-and-resources"]], "Community Land Model (CLM) output": [[80, "community-land-model-clm-output"]], "Community Meetings": [[6, "community-meetings"]], "Community Terrestrial Systems Model (CTSM) Python Gallery": [[92, "community-terrestrial-systems-model-ctsm-python-gallery"]], "Community Working Group": [[2, "community-working-group"]], "Compare the Model to Observations": [[61, "compare-the-model-to-observations"]], "Comparing Atmospheric Model Output with Observations Using Intake-ESM": [[41, "comparing-atmospheric-model-output-with-observations-using-intake-esm"]], "Compute": [[83, "compute"]], "Compute Monthly and Seasonal Averages": [[41, "compute-monthly-and-seasonal-averages"]], "Compute the Averages": [[46, "compute-the-averages"]], "Compute the Monthly Mean using Geocat-Comp": [[61, "compute-the-monthly-mean-using-geocat-comp"]], "Compute the Temporal Average": [[39, "compute-the-temporal-average"]], "Compute the Weighted Annual Averages": [[46, "compute-the-weighted-annual-averages"]], "Compute the Weighted Temporal Mean from Seasons": [[46, "compute-the-weighted-temporal-mean-from-seasons"]], "Conclusion": [[17, "conclusion"], [28, "conclusion"], [36, "conclusion"], [37, "conclusion"], [39, "conclusion"], [41, "conclusion"], [50, "conclusion"], [61, "conclusion"], [62, "conclusion"], [65, "conclusion"], [68, "conclusion"]], "Conclusions": [[20, "conclusions"], [44, "conclusions"], [67, "conclusions"]], "Conda Questions": [[30, "conda-questions"]], "Conda is taking too long to solve environment: use mamba": [[7, "conda-is-taking-too-long-to-solve-environment-use-mamba"]], "Conference Summaries, Discussions, and Resources": [[32, "conference-summaries-discussions-and-resources"]], "Confirm that the output files were properly written": [[17, "confirm-that-the-output-files-were-properly-written"]], "Conlcusion": [[23, "conlcusion"]], "Considering Joining the Office Hours Team?": [[88, "considering-joining-the-office-hours-team"]], "Construct a Regridder.": [[72, "construct-a-regridder"]], "Constructing a sparse array": [[80, "constructing-a-sparse-array"]], "Contents": [[83, "contents"]], "Convert a single timestep to sparse": [[80, "convert-a-single-timestep-to-sparse"]], "Convert multiple timesteps to sparse": [[80, "convert-multiple-timesteps-to-sparse"]], "Convert the dataset into a dataframe": [[46, "convert-the-dataset-into-a-dataframe"]], "Convert to Dataframes": [[46, "convert-to-dataframes"]], "Converting to Standard Units": [[65, "converting-to-standard-units"]], "Copy the link from Github": [[50, "copy-the-link-from-github"]], "Correctly Calculating Annual Averages with Xarray": [[68, "correctly-calculating-annual-averages-with-xarray"]], "Covered in this tutorial": [[35, "covered-in-this-tutorial"]], "Create a dask cluster": [[87, "create-a-dask-cluster"]], "Create a docs directory": [[50, "create-a-docs-directory"]], "Create a helper function for generating a filepath": [[17, "create-a-helper-function-for-generating-a-filepath"]], "Create a helper function to split a dataset into sub-datasets": [[17, "create-a-helper-function-to-split-a-dataset-into-sub-datasets"]], "Create reference file for each netCDF file": [[84, "create-reference-file-for-each-netcdf-file"]], "Create sparse matrix map": [[83, "create-sparse-matrix-map"]], "Create the filesystem and mapper": [[86, "create-the-filesystem-and-mapper"]], "Create your Github Repository": [[50, "create-your-github-repository"]], "Creating Model Documentation Using Jupyterbook and Intake-esm": [[50, "creating-model-documentation-using-jupyterbook-and-intake-esm"]], "Creating Visualizations of Intake-ESM Catalogs": [[36, "creating-visualizations-of-intake-esm-catalogs"]], "Creating a new data pipeline": [[87, "creating-a-new-data-pipeline"]], "Creating and accessing a new conda environment on the NSF NCAR JupyterHub": [[7, "creating-and-accessing-a-new-conda-environment-on-the-nsf-ncar-jupyterhub"]], "Creating helper functions for plotting": [[39, "creating-helper-functions-for-plotting"]], "Creating our Derived Variable Registry": [[38, "creating-our-derived-variable-registry"]], "Dask": [[29, "dask"]], "Dask Distributed Summit 2021 Takeaways": [[25, "dask-distributed-summit-2021-takeaways"]], "Dask Questions": [[30, "dask-questions"], [31, "dask-questions"]], "Dask Tutorial": [[26, "dask-tutorial"]], "Dask Tutorial (14 July and 11 August 2021)": [[32, "dask-tutorial-14-july-and-11-august-2021"]], "Dask Tutorial UPDATED DATES": [[27, "dask-tutorial-updated-dates"]], "Dask on HPC Talk Links": [[25, "dask-on-hpc-talk-links"]], "Dask on High Performance Computing Systems": [[25, "dask-on-high-performance-computing-systems"]], "Data Access": [[32, "data-access"]], "Data Computation": [[30, "data-computation"], [31, "data-computation"], [32, "data-computation"]], "Data Operation": [[47, "data-operation"]], "Data Visualization": [[32, "data-visualization"]], "Datashader": [[23, "datashader"]], "Dealing with CESM monthly output - is there something wrong with time": [[7, "dealing-with-cesm-monthly-output-is-there-something-wrong-with-time"]], "Dealing with Relative vs. Absolute Paths": [[18, "dealing-with-relative-vs-absolute-paths"]], "Dealing with the time": [[65, "dealing-with-the-time"]], "Debugging Intake-ESM Process for Reading in CMIP6": [[42, "debugging-intake-esm-process-for-reading-in-cmip6"]], "Debugging dask workflows: Detrending": [[73, "debugging-dask-workflows-detrending"]], "Define a function that reads in map file (weights) and constructs a sparse array": [[83, "define-a-function-that-reads-in-map-file-weights-and-constructs-a-sparse-array"]], "Define a function to apply weights using this method": [[83, "define-a-function-to-apply-weights-using-this-method"]], "Define a function to remap using weights file": [[83, "define-a-function-to-remap-using-weights-file"]], "Define a helper function which subsets the data, groups by year, and returns the data array": [[37, "define-a-helper-function-which-subsets-the-data-groups-by-year-and-returns-the-data-array"]], "Define regridding function that constructs an xESMF regridder": [[83, "define-regridding-function-that-constructs-an-xesmf-regridder"]], "Demo: reading a dataset": [[86, "demo-reading-a-dataset"]], "Demonstration": [[81, "demonstration"]], "Determining the Cause of the Error": [[42, "determining-the-cause-of-the-error"]], "Diagnostic Efforts": [[92, "diagnostic-efforts"]], "Diagnostic Packages": [[29, "diagnostic-packages"]], "Discovery": [[63, "discovery"]], "Distributed client with adaptive scaling": [[83, "distributed-client-with-adaptive-scaling"]], "Documentation and Citations": [[32, "documentation-and-citations"]], "Download a sample CESM logo": [[50, "download-a-sample-cesm-logo"]], "Downloading the beta version of ecgtools": [[28, "downloading-the-beta-version-of-ecgtools"]], "ESDS Activities Calendar": [[6, "esds-activities-calendar"]], "ESDS Blog Contributors Guide": [[0, "esds-blog-contributors-guide"]], "ESDS Blog Posts": [[30, "esds-blog-posts"], [31, "esds-blog-posts"]], "ESDS Committees and Working Groups": [[2, "esds-committees-and-working-groups"]], "ESDS Forum": [[6, "esds-forum"], [30, "esds-forum"], [31, "esds-forum"]], "ESDS GitHub Repository": [[6, "esds-github-repository"]], "ESDS Office Hours Support": [[88, "esds-office-hours-support"]], "ESDS Progress Over the Past Few Months": [[32, "esds-progress-over-the-past-few-months"]], "ESDS Representatives": [[2, "esds-representatives"]], "ESDS Update November 2021": [[30, "esds-update-november-2021"]], "ESDS Update October 2021": [[31, "esds-update-october-2021"]], "ESDS and other NCAR/UCAR contributions:": [[89, "esds-and-other-ncar-ucar-contributions"]], "ESDS at SciPy 2023": [[89, "esds-at-scipy-2023"]], "Earth System Data Science (ESDS)": [[1, "earth-system-data-science-esds"]], "Earth System Data Science (ESDS) Initiative": [[8, "earth-system-data-science-esds-initiative"]], "Earth system model Catalog Generation Tools (ecgtools)": [[92, "earth-system-model-catalog-generation-tools-ecgtools"]], "Easy visualization": [[80, "easy-visualization"]], "Email List": [[6, "email-list"]], "End to End Workflow": [[30, "end-to-end-workflow"], [31, "end-to-end-workflow"], [32, "end-to-end-workflow"]], "Environment Install": [[75, "environment-install"]], "Esm_catalog_utils": [[92, "esm-catalog-utils"]], "Event Recordings": [[76, "event-recordings"]], "Events Working Group": [[2, "events-working-group"]], "Examine of the files": [[67, "examine-of-the-files"]], "Examining Diagnostics Using Intake-ESM and hvPlot": [[39, "examining-diagnostics-using-intake-esm-and-hvplot"]], "Example detrending operation": [[73, "example-detrending-operation"]], "Example of case visualization": [[36, "example-of-case-visualization"]], "Example using new Casper-batch login": [[22, "example-using-new-casper-batch-login"]], "Extract surface temperature variable (TS)": [[83, "extract-surface-temperature-variable-ts"]], "Extract the Grid Area and Compute the Total Area": [[46, "extract-the-grid-area-and-compute-the-total-area"]], "Fair Warning": [[50, "fair-warning"]], "Falko Judt (MMM):": [[90, "falko-judt-mmm"]], "Final Thoughts": [[71, "final-thoughts"]], "Finally": [[73, "finally"]], "First create a list of files": [[87, "first-create-a-list-of-files"]], "Fix the time on the observations": [[61, "fix-the-time-on-the-observations"]], "Foundations Book": [[59, "foundations-book"]], "Frequently Asked Questions": [[7, "frequently-asked-questions"]], "Funding": [[29, "funding"]], "Further reading": [[83, "further-reading"]], "Future work": [[73, "future-work"]], "Gather a list of files available from an Amazon s3 bucket": [[84, "gather-a-list-of-files-available-from-an-amazon-s3-bucket"]], "General Advice": [[7, "general-advice"]], "General Discussion": [[30, "general-discussion"], [31, "general-discussion"]], "General tips": [[7, "general-tips"]], "Generate references for the sfc and h datasets": [[86, "generate-references-for-the-sfc-and-h-datasets"]], "Generate the Mapper Files": [[84, "generate-the-mapper-files"]], "GeoCAT": [[92, "geocat"]], "GeoCAT Comp Tutorial (08 September 2021)": [[32, "geocat-comp-tutorial-08-september-2021"]], "GeoCAT Viz Tutorial (25 August 2021)": [[32, "geocat-viz-tutorial-25-august-2021"]], "GeoCAT-Comp Tutorial": [[33, "geocat-comp-tutorial"]], "GeoCAT-comp": [[92, "geocat-comp"]], "GeoCAT-examples": [[92, "geocat-examples"]], "GeoCAT-viz": [[92, "geocat-viz"]], "Geoviews": [[23, "geoviews"]], "Git and GitHub Tutorial": [[35, "git-and-github-tutorial"]], "Git and Github Tutorial (12 May 2021)": [[32, "git-and-github-tutorial-12-may-2021"]], "GitHub": [[7, "github"]], "Given that much of the diagnostic development comes from volunteers in the user community, how could you or your colleagues contribute": [[24, "given-that-much-of-the-diagnostic-development-comes-from-volunteers-in-the-user-community-how-could-you-or-your-colleagues-contribute"]], "Go checkout your book!": [[50, "go-checkout-your-book"]], "Goal": [[80, "goal"]], "Grab a list of files": [[67, "grab-a-list-of-files"]], "Grab some Observational Data": [[46, "grab-some-observational-data"]], "Growth and History of Anaconda + Numpy + SciPy + Dask": [[25, "growth-and-history-of-anaconda-numpy-scipy-dask"]], "Help topics:": [[7, "help-topics"]], "Help, my analysis is slow!": [[7, "help-my-analysis-is-slow"]], "Helper function to make all of the plots the same way but with different data": [[81, "helper-function-to-make-all-of-the-plots-the-same-way-but-with-different-data"]], "Helpful Templates": [[4, "helpful-templates"]], "HiRes-CESM Interactive Dashboard Example": [[18, "hires-cesm-interactive-dashboard-example"]], "Holoviews": [[23, "holoviews"]], "How can I export my environments?": [[7, "how-can-i-export-my-environments"]], "How can I use the new updates to NCAR-jobqueue?": [[52, "how-can-i-use-the-new-updates-to-ncar-jobqueue"]], "How can we tie this back to ESDS?": [[25, "how-can-we-tie-this-back-to-esds"]], "How could we better enable contributions?": [[24, "how-could-we-better-enable-contributions"]], "How do I debug my code when using Dask?": [[7, "how-do-i-debug-my-code-when-using-dask"]], "How do I mint a DOI for my repository if I am outside the NCAR organization?": [[64, "how-do-i-mint-a-doi-for-my-repository-if-i-am-outside-the-ncar-organization"]], "How do I optimize reading multiple files using Xarray and Dask?": [[7, "how-do-i-optimize-reading-multiple-files-using-xarray-and-dask"]], "How do I use conda environments?": [[7, "how-do-i-use-conda-environments"]], "How do we find these projects?": [[29, "how-do-we-find-these-projects"]], "How do you Incorporate Diagnostics within your Workflow?": [[24, "how-do-you-incorporate-diagnostics-within-your-workflow"]], "How else should I make sure people cite my software?": [[64, "how-else-should-i-make-sure-people-cite-my-software"]], "How is NCAR-Jobqueue different than Dask-Jobqueue": [[52, "how-is-ncar-jobqueue-different-than-dask-jobqueue"]], "How to Parameterize Notebooks": [[44, "how-to-parameterize-notebooks"]], "How to Use xarray.map_blocks for Vertical Interpolation of a 3D Field": [[47, "how-to-use-xarray-map-blocks-for-vertical-interpolation-of-a-3d-field"]], "How to add a Derived Variable": [[38, "how-to-add-a-derived-variable"]], "How to use Papermill": [[71, "how-to-use-papermill"]], "How would I use this on within my workflow on Casper?": [[52, "how-would-i-use-this-on-within-my-workflow-on-casper"]], "How-to-Run": [[40, "how-to-run"], [56, "how-to-run"], [70, "how-to-run"], [78, "how-to-run"], [82, "how-to-run"]], "I have to do lots of rechunking, but the rechunk step uses too much memory and kills my workers.": [[7, "i-have-to-do-lots-of-rechunking-but-the-rechunk-step-uses-too-much-memory-and-kills-my-workers"]], "Importing Libraries": [[80, "importing-libraries"]], "Imports": [[20, "imports"], [23, "imports"], [28, "imports"], [36, "imports"], [37, "imports"], [38, "imports"], [39, "imports"], [41, "imports"], [46, "imports"], [50, "imports"], [61, "imports"], [65, "imports"], [67, "imports"], [68, "imports"], [81, "imports"], [83, "imports"], [84, "imports"]], "Imports and Data Ingestion": [[47, "imports-and-data-ingestion"]], "Indexing unstructured grids with the Power of Xoak": [[51, "indexing-unstructured-grids-with-the-power-of-xoak"]], "Inheritance": [[15, "inheritance"]], "Inlining data": [[86, "inlining-data"]], "Inspect the Catalog": [[28, "inspect-the-catalog"]], "Install Github Pages Import": [[50, "install-github-pages-import"]], "Installing packages via conda-forge": [[20, "installing-packages-via-conda-forge"]], "Installing the Development Version of Intake-ESM": [[38, "installing-the-development-version-of-intake-esm"]], "Installing xwrf": [[67, "installing-xwrf"]], "Instead use opt_einsum": [[83, "instead-use-opt-einsum"]], "Intake-ESM Tutorial": [[40, "intake-esm-tutorial"]], "Intake-esm": [[92, "intake-esm"]], "Interactive Computing": [[29, "interactive-computing"]], "Intercomparison of History": [[20, "intercomparison-of-history"]], "Intercomparison of Timeseries": [[20, "intercomparison-of-timeseries"]], "Interpolate Vertical Levels": [[61, "interpolate-vertical-levels"]], "Introduction": [[46, "introduction"]], "Introduction + What/Why Dask": [[62, "introduction-what-why-dask"]], "Introduction to Distributed Computing": [[62, "introduction-to-distributed-computing"]], "Introduction to sparse arrays": [[80, "introduction-to-sparse-arrays"]], "Investigate the Data": [[67, "investigate-the-data"]], "Investigate the File Structure and Sample Dataset": [[41, "investigate-the-file-structure-and-sample-dataset"]], "Investigate the Variables": [[67, "investigate-the-variables"]], "Investigate the Vertical Levels": [[67, "investigate-the-vertical-levels"]], "Invited Talk": [[91, "invited-talk"]], "Invoke xr.save_mfdataset()": [[17, "invoke-xr-save-mfdataset"]], "Is it fixed?": [[73, "is-it-fixed"]], "Jinja2": [[15, "jinja2"]], "Jinja2 Statements": [[15, "jinja2-statements"]], "Jupyter Notebooks Tutorial FAQ": [[45, "jupyter-notebooks-tutorial-faq"]], "Katie Dagon (CGD):": [[90, "katie-dagon-cgd"]], "Keynote - Fernando Perez - SciPy and Open Source Toolsin Sicence: Challenges and Successes": [[63, "keynote-fernando-perez-scipy-and-open-source-toolsin-sicence-challenges-and-successes"]], "KilledWorker X{. What do I do?": [[7, "killedworker-x-what-do-i-do"]], "Leadership Committee": [[2, "leadership-committee"]], "Learning Resources": [[6, "learning-resources"]], "Lets look at detrend": [[73, "lets-look-at-detrend"]], "Let\u2019s look at polyfit again": [[73, "let-s-look-at-polyfit-again"]], "Load in our computation": [[39, "load-in-our-computation"]], "Load in our datasets using .to_dataset_dict()": [[46, "load-in-our-datasets-using-to-dataset-dict"]], "Load in the CESM2-LE Data": [[68, "load-in-the-cesm2-le-data"]], "Load some toy dataset": [[17, "load-some-toy-dataset"]], "Local Install": [[75, "local-install"]], "Look at one of the datasets": [[37, "look-at-one-of-the-datasets"]], "Looking at the Dashboard": [[62, "looking-at-the-dashboard"]], "Looping through the CESM-LE catalog": [[36, "looping-through-the-cesm-le-catalog"]], "Main Challenge": [[37, "main-challenge"]], "Main Takeaways from the Discussion": [[24, "main-takeaways-from-the-discussion"]], "Main \u201ccomponents\u201d of Graphviz": [[36, "main-components-of-graphviz"]], "Make a test plot": [[80, "make-a-test-plot"]], "Make source / destination grids": [[83, "make-source-destination-grids"]], "Managing Computational Resources": [[4, "managing-computational-resources"]], "Many xarray operations just work": [[80, "many-xarray-operations-just-work"]], "Matplotlib Questions": [[30, "matplotlib-questions"], [31, "matplotlib-questions"]], "Matplotlib Tutorial": [[49, "matplotlib-tutorial"]], "Matplotlib Tutorial (24 March 2021)": [[32, "matplotlib-tutorial-24-march-2021"]], "Matplotlib Tutorial FAQ": [[48, "matplotlib-tutorial-faq"]], "Membership & Participation": [[6, "membership-participation"]], "Merge the reference files together": [[84, "merge-the-reference-files-together"]], "MetPy Tutorial": [[78, "metpy-tutorial"]], "Modify the Time values as well\u2026": [[67, "modify-the-time-values-as-well"]], "Modular Ocean Model (MOM6)-tools": [[92, "modular-ocean-model-mom6-tools"]], "My Dask workers are taking a long time to start. How can I monitor them?": [[7, "my-dask-workers-are-taking-a-long-time-to-start-how-can-i-monitor-them"]], "NCAR-CGD ESDS Town Hall": [[29, "ncar-cgd-esds-town-hall"]], "NCAR-Jobqueue": [[52, "ncar-jobqueue"]], "NPL on the NSF NCAR JupyterHub": [[7, "npl-on-the-nsf-ncar-jupyterhub"]], "NPL on the command line": [[7, "npl-on-the-command-line"]], "NSF NCAR HPC Best Practices": [[4, "nsf-ncar-hpc-best-practices"]], "Nbscuid": [[92, "nbscuid"]], "Near-term Goals": [[2, "near-term-goals"]], "New Insights": [[63, "new-insights"]], "New Office Hours Appointment System": [[79, "new-office-hours-appointment-system"]], "Next": [[86, "next"]], "Note that on-disk chunking matters": [[87, "note-that-on-disk-chunking-matters"]], "NumPy Tutorial FAQ": [[53, "numpy-tutorial-faq"]], "Numpy Tutorial": [[54, "numpy-tutorial"]], "Numpy Tutorial (10 March 2021)": [[32, "numpy-tutorial-10-march-2021"]], "OCEtrac - Ocetrac: morphological image processing for monitoring marine heatwaves": [[63, "ocetrac-ocetrac-morphological-image-processing-for-monitoring-marine-heatwaves"]], "Object Oriented Programming Tutorial": [[30, "object-oriented-programming-tutorial"], [55, "object-oriented-programming-tutorial"], [56, "object-oriented-programming-tutorial"]], "Object Oriented Programming Tutorial (09 April 2021)": [[32, "object-oriented-programming-tutorial-09-april-2021"]], "Office Hour Questions": [[30, "office-hour-questions"], [31, "office-hour-questions"]], "Office Hours": [[6, "office-hours"], [9, "office-hours"], [32, "office-hours"]], "Option 1: from the command line": [[71, "option-1-from-the-command-line"]], "Option 2: from another Python script or Jupyter notebook": [[71, "option-2-from-another-python-script-or-jupyter-notebook"]], "Organization": [[6, "organization"]], "Orhan Eroglu (CISL):": [[90, "orhan-eroglu-cisl"]], "Over-arching Comments": [[24, "over-arching-comments"]], "Overall Design": [[29, "overall-design"]], "Overview": [[83, "overview"], [91, "overview"]], "Overview of CESM Workshop": [[24, "overview-of-cesm-workshop"]], "Overview of Dask and Dashboards": [[62, "overview-of-dask-and-dashboards"]], "Overview of the Cluster": [[62, "overview-of-the-cluster"]], "Package Template": [[4, "package-template"]], "Package imports": [[17, "package-imports"]], "Paired Programming using VS Code": [[57, "paired-programming-using-vs-code"]], "Pandas Tutorial": [[58, "pandas-tutorial"]], "Pandas Tutorial (26 May 2021)": [[32, "pandas-tutorial-26-may-2021"]], "Pangeo Session": [[25, "pangeo-session"]], "Pangeo Session Talk Links": [[25, "pangeo-session-talk-links"]], "Parallel Ocean Program (POP)-tools": [[92, "parallel-ocean-program-pop-tools"]], "Parallel Writing/Zarr": [[29, "parallel-writing-zarr"]], "Parameterizing Code Cells": [[44, "parameterizing-code-cells"]], "Parameterizing Markdown Cells": [[44, "parameterizing-markdown-cells"]], "Part 1": [[32, "part-1"], [32, "id1"]], "Part 2": [[32, "part-2"], [32, "id2"]], "Past Committee Members": [[2, "past-committee-members"]], "Perform a computation on input dataset": [[17, "perform-a-computation-on-input-dataset"]], "Plan": [[90, "plan"]], "Please join us (virtually) on the following dates:": [[60, "please-join-us-virtually-on-the-following-dates"]], "Please show me the code": [[17, "please-show-me-the-code"]], "Plot CESM2-LE Temperature Climatologies": [[41, "plot-cesm2-le-temperature-climatologies"]], "Plot Monthly Temperature Climatologies from Observations": [[41, "plot-monthly-temperature-climatologies-from-observations"]], "Plot Observational Temperature Climatologies": [[41, "plot-observational-temperature-climatologies"]], "Plot Seasonal Temperature Climatologies from Observations": [[41, "plot-seasonal-temperature-climatologies-from-observations"]], "Plot a Comparison of Wall time for Different Computations": [[20, "plot-a-comparison-of-wall-time-for-different-computations"]], "Plot a Comparison using Holoviews": [[39, "plot-a-comparison-using-holoviews"]], "Plot an Interactive Map using hvPlot": [[61, "plot-an-interactive-map-using-hvplot"]], "Plot our Results!": [[37, "plot-our-results"]], "Plot our final comparisons": [[39, "plot-our-final-comparisons"]], "Plot the Output": [[38, "plot-the-output"], [46, "plot-the-output"]], "Plot the Output using hvPlot": [[67, "plot-the-output-using-hvplot"]], "Plot the output from the Mapper Method": [[84, "plot-the-output-from-the-mapper-method"]], "Plot the result using Datashader + Geoviews/Holoviews": [[23, "plot-the-result-using-datashader-geoviews-holoviews"]], "Plot up the Monthly Mean Temperature": [[41, "plot-up-the-monthly-mean-temperature"]], "Plot up the Seasonal Mean Temperature": [[41, "plot-up-the-seasonal-mean-temperature"]], "Plotting CESM Data on an Unstructured Grid using Geoviews and Datashader": [[23, "plotting-cesm-data-on-an-unstructured-grid-using-geoviews-and-datashader"]], "Plotting an Interactive Meteogram": [[65, "plotting-an-interactive-meteogram"]], "Plotting with GeoCAT Tutorial": [[34, "plotting-with-geocat-tutorial"]], "Pop-Tools": [[29, "pop-tools"]], "Possible improvements": [[72, "possible-improvements"]], "Posters:": [[89, "posters"]], "Potential opportunities for improvements": [[47, "potential-opportunities-for-improvements"]], "Preparation": [[19, "preparation"], [21, "preparation"], [26, "preparation"], [27, "preparation"], [33, "preparation"], [34, "preparation"], [49, "preparation"], [54, "preparation"], [55, "preparation"], [58, "preparation"], [66, "preparation"]], "Preparation before tutorial": [[35, "preparation-before-tutorial"]], "Preparation for a (Re)Introduction to Earth System Data Science (ESDS) Across NCAR/UCAR/UCP": [[75, "preparation-for-a-re-introduction-to-earth-system-data-science-esds-across-ncar-ucar-ucp"]], "Presentation Slides": [[76, "presentation-slides"]], "Processing Data from the NCAR Mesa Lab Weather Station": [[65, "processing-data-from-the-ncar-mesa-lab-weather-station"]], "Project Pythia": [[6, "project-pythia"]], "Project Pythia Portal Overview": [[59, "project-pythia-portal-overview"]], "Projects": [[92, "projects"]], "Publications and Citations": [[29, "publications-and-citations"]], "Putting it all together": [[80, "putting-it-all-together"]], "Python Package Overviews": [[30, "python-package-overviews"], [31, "python-package-overviews"], [32, "python-package-overviews"]], "Python Tutorial FAQ": [[12, "python-tutorial-faq"]], "Python Tutorial FAQ - Part 2": [[13, "python-tutorial-faq-part-2"]], "Python Tutorial FAQ - Part 3": [[14, "python-tutorial-faq-part-3"]], "Python Tutorial Seminar Series - Spring 2021": [[60, "python-tutorial-seminar-series-spring-2021"]], "Python Tutorial(s)": [[30, "python-tutorial-s"], [31, "python-tutorial-s"]], "Python Tutorials": [[32, "python-tutorials"]], "Query and Subset our Catalog": [[37, "query-and-subset-our-catalog"]], "Query for monthly temperature (T) values, using the historical experiment": [[41, "query-for-monthly-temperature-t-values-using-the-historical-experiment"]], "Querying for our desired variable": [[37, "querying-for-our-desired-variable"]], "Question": [[80, "question"]], "Question and Answer Portion": [[29, "question-and-answer-portion"]], "Read": [[87, "read"]], "Read and concatenate the whole dataset": [[87, "read-and-concatenate-the-whole-dataset"]], "Read data": [[72, "read-data"]], "Read directly from S3 (without kerchunk)": [[84, "read-directly-from-s3-without-kerchunk"]], "Read in CAM-SE output": [[83, "read-in-cam-se-output"], [83, "id1"], [83, "id4"], [83, "id6"]], "Read in CESM Output": [[41, "read-in-cesm-output"]], "Read in Data": [[46, "read-in-data"]], "Read in Data with our Registry": [[38, "read-in-data-with-our-registry"]], "Read in Model Data": [[61, "read-in-model-data"]], "Read in Observational Data from the Catalog": [[41, "read-in-observational-data-from-the-catalog"]], "Read in Observational Data from the World Ocean Atlas": [[61, "read-in-observational-data-from-the-world-ocean-atlas"]], "Read in a dictionary of datasets": [[39, "read-in-a-dictionary-of-datasets"]], "Read in and format data": [[81, "read-in-and-format-data"]], "Read in intake-esm catalog": [[36, "read-in-intake-esm-catalog"]], "Read in map file (weights)": [[83, "read-in-map-file-weights"], [83, "id2"]], "Read in the CSV File Containing Metadata": [[18, "read-in-the-csv-file-containing-metadata"]], "Read in the Data using Xarray": [[61, "read-in-the-data-using-xarray"]], "Read in the Dataset": [[67, "read-in-the-dataset"]], "Read in the Grid Data": [[46, "read-in-the-grid-data"]], "Read in the Test History Catalog": [[50, "read-in-the-test-history-catalog"]], "Read in the data": [[23, "read-in-the-data"], [39, "read-in-the-data"]], "Read in the data catalog": [[37, "read-in-the-data-catalog"]], "Read in using .to_dataset_dict()": [[37, "read-in-using-to-dataset-dict"]], "Read in weights": [[83, "read-in-weights"]], "Read the CESM-LE data": [[43, "read-the-cesm-le-data"]], "Read the Catalog and Visualize the Components and Frequency": [[50, "read-the-catalog-and-visualize-the-components-and-frequency"]], "Read the Catalogs Using Intake-ESM": [[20, "read-the-catalogs-using-intake-esm"]], "Read the weights file": [[72, "read-the-weights-file"]], "Reading WRF data into Xarray and Visualizing the Output using hvPlot": [[67, "reading-wrf-data-into-xarray-and-visualizing-the-output-using-hvplot"]], "Reading the combined dataset": [[86, "reading-the-combined-dataset"]], "Rebuilding your book": [[50, "rebuilding-your-book"]], "Recap": [[90, "recap"]], "Recap of a (Re)Introduction to Earth System Data Science (ESDS) Across NCAR/UCAR/UCP": [[76, "recap-of-a-re-introduction-to-earth-system-data-science-esds-across-ncar-ucar-ucp"]], "Recap: Unstructured Grid Collaborative Work Time": [[90, "recap-unstructured-grid-collaborative-work-time"]], "Recent posts": [[8, "recent-posts"]], "Regrid and Interpolate Vertical Levels": [[61, "regrid-and-interpolate-vertical-levels"]], "Regrid using xESMF": [[61, "regrid-using-xesmf"]], "Regridding High Resolution Observations to a High Resolution Model Grid": [[61, "regridding-high-resolution-observations-to-a-high-resolution-model-grid"]], "Regridding using xESMF and an existing weights file": [[72, "regridding-using-xesmf-and-an-existing-weights-file"]], "Regridding with xESMF": [[72, "regridding-with-xesmf"]], "Reimagining Diagnostics Through the Use of the Jupyter Ecosystem": [[44, "reimagining-diagnostics-through-the-use-of-the-jupyter-ecosystem"]], "Reproducing the Error": [[42, "reproducing-the-error"]], "Reshape 1-D vector to destination grid": [[83, "reshape-1-d-vector-to-destination-grid"]], "Reshape destination grid to build structured data array": [[83, "reshape-destination-grid-to-build-structured-data-array"]], "Resource Gallery": [[59, "resource-gallery"]], "Resources": [[91, "resources"]], "Resources Guide": [[76, "resources-guide"]], "Run the Dashboard Inline": [[18, "run-the-dashboard-inline"]], "Running this": [[63, "running-this"]], "Running this on the Entire Dataset": [[47, "running-this-on-the-entire-dataset"]], "Save the Catalog": [[28, "save-the-catalog"]], "Save the Visualization": [[50, "save-the-visualization"]], "Save the catalog": [[41, "save-the-catalog"]], "Save the catalog locally": [[20, "save-the-catalog-locally"], [20, "id1"]], "Saving data": [[62, "saving-data"]], "Scaling Python with Dask Class Takeaways": [[62, "scaling-python-with-dask-class-takeaways"]], "SciPy Conference 2021 Takeaways": [[63, "scipy-conference-2021-takeaways"]], "Search for Just Monthly Ocean Output": [[20, "search-for-just-monthly-ocean-output"]], "Search for your problem": [[74, "search-for-your-problem"]], "Session homework": [[75, "session-homework"]], "Set CAM-SE output location and map file": [[83, "set-cam-se-output-location-and-map-file"]], "Setting up GitHub Authentication": [[7, "setting-up-github-authentication"]], "Setting up an Analysis Configuration File": [[44, "setting-up-an-analysis-configuration-file"]], "Setting up our Jupyter Book Table of Contents": [[44, "setting-up-our-jupyter-book-table-of-contents"]], "Setting up the imports/dask": [[43, "setting-up-the-imports-dask"]], "Setting up the \u201cPreprocessing\u201d Notebooks": [[44, "setting-up-the-preprocessing-notebooks"]], "Setup": [[73, "setup"], [86, "setup"]], "Setup our Temperature Plots": [[65, "setup-our-temperature-plots"]], "Setup our Wind Plots": [[65, "setup-our-wind-plots"]], "Setup the Computation - Below, we lazily prepare the calculation!": [[46, "setup-the-computation-below-we-lazily-prepare-the-calculation"]], "Setup the traiangulate function, described in the datashader.Trimesh documentation": [[23, "setup-the-traiangulate-function-described-in-the-datashader-trimesh-documentation"]], "Shifting Landscape of Technical Tools": [[29, "shifting-landscape-of-technical-tools"]], "Sign Up": [[16, "sign-up"], [19, "sign-up"], [21, "sign-up"], [26, "sign-up"], [27, "sign-up"], [33, "sign-up"], [34, "sign-up"], [35, "sign-up"], [40, "sign-up"], [49, "sign-up"], [54, "sign-up"], [55, "sign-up"], [56, "sign-up"], [58, "sign-up"], [60, "sign-up"], [66, "sign-up"], [70, "sign-up"], [78, "sign-up"], [82, "sign-up"]], "Simple example: generate references for the static file": [[86, "simple-example-generate-references-for-the-static-file"]], "Simple xarray.open_dataset": [[86, "simple-xarray-open-dataset"]], "So what\u2019s the difference?": [[81, "so-what-s-the-difference"]], "Software Design": [[4, "software-design"]], "Software Engineering Working Group Meeting": [[24, "software-engineering-working-group-meeting"]], "Someone must have written the function I want. Where do I look?": [[7, "someone-must-have-written-the-function-i-want-where-do-i-look"]], "Sparse arrays and the CESM land model component": [[80, "sparse-arrays-and-the-cesm-land-model-component"]], "Sparse arrays with dask": [[80, "sparse-arrays-with-dask"]], "Sparse arrays with dask + xarray": [[80, "sparse-arrays-with-dask-xarray"]], "Spin Down the Cluster": [[46, "spin-down-the-cluster"]], "Spin up Dask Cluster": [[43, "spin-up-dask-cluster"]], "Spin up a Cluster": [[46, "spin-up-a-cluster"], [67, "spin-up-a-cluster"], [68, "spin-up-a-cluster"], [83, "spin-up-a-cluster"], [84, "spin-up-a-cluster"]], "Spin up a Dask Cluster": [[20, "spin-up-a-dask-cluster"], [38, "spin-up-a-dask-cluster"], [39, "spin-up-a-dask-cluster"]], "Spin up our Dask Cluster": [[37, "spin-up-our-dask-cluster"]], "Start Learning": [[59, "start-learning"]], "Start by opening a single file": [[87, "start-by-opening-a-single-file"]], "Step 1: Prepare the notebook": [[71, "step-1-prepare-the-notebook"]], "Step 2: Prepare the execution environment": [[71, "step-2-prepare-the-execution-environment"]], "Step 3: Running the notebook": [[71, "step-3-running-the-notebook"]], "Steps to Create Your Own Office Hours Appointment": [[88, "steps-to-create-your-own-office-hours-appointment"]], "Subset for Daily Temperature Data (TREFHT)": [[46, "subset-for-daily-temperature-data-trefht"]], "Subset for monthly output from the last 20 years": [[39, "subset-for-monthly-output-from-the-last-20-years"]], "Subset for time - here, we are interested in year 24 through 53": [[61, "subset-for-time-here-we-are-interested-in-year-24-through-53"]], "Summary": [[73, "summary"], [73, "id1"], [80, "summary"], [83, "summary"], [84, "summary"], [86, "summary"]], "Summary of the timing test:": [[83, "summary-of-the-timing-test"]], "Take a Look at the Difference": [[68, "take-a-look-at-the-difference"]], "Takeaways": [[90, "takeaways"]], "Taking a Look at the Interactive Plots": [[44, "taking-a-look-at-the-interactive-plots"]], "Talk to yourself": [[74, "talk-to-yourself"]], "Talks": [[89, "talks"]], "Templating isn\u2019t just for Web Developers!": [[15, "templating-isn-t-just-for-web-developers"]], "Test File Access Speeds": [[20, "test-file-access-speeds"]], "Test out the History Files": [[20, "test-out-the-history-files"]], "Test out the Timeseries Files": [[20, "test-out-the-timeseries-files"]], "Test with a small subset": [[87, "test-with-a-small-subset"]], "The Case for cftime.DatetimeNoLeap": [[11, "the-case-for-cftime-datetimenoleap"]], "The Case for datetime64": [[11, "the-case-for-datetime64"]], "The Data": [[65, "the-data"], [68, "the-data"]], "The Importance of Software Citation": [[64, "the-importance-of-software-citation"]], "The Jinja2 Template": [[15, "the-jinja2-template"]], "The Letter": [[15, "the-letter"]], "The Pangeo-Forge Method": [[61, "the-pangeo-forge-method"]], "The Problem": [[65, "the-problem"], [68, "the-problem"]], "The Pythia Portal": [[59, "the-pythia-portal"]], "The Python Tutorial Series Returns this Summer!": [[82, "the-python-tutorial-series-returns-this-summer"]], "The Significance of Time": [[11, "the-significance-of-time"]], "The Solution": [[65, "the-solution"], [68, "the-solution"]], "The Task": [[11, "the-task"]], "The Temptation": [[11, "the-temptation"]], "The Tribulation": [[11, "the-tribulation"]], "The Use Case": [[15, "the-use-case"]], "The best of both worlds": [[11, "the-best-of-both-worlds"]], "The correct way to compute seasonal averages with xarray": [[81, "the-correct-way-to-compute-seasonal-averages-with-xarray"]], "The incorrect way to compute seasonal averages from monthly data": [[81, "the-incorrect-way-to-compute-seasonal-averages-from-monthly-data"]], "Themes from the Diagnostic Discussion": [[24, "themes-from-the-diagnostic-discussion"]], "Thinking through CESM data access": [[87, "thinking-through-cesm-data-access"]], "Tidy Geospatial Cubes": [[89, "tidy-geospatial-cubes"]], "Timing performance for core multiply-add": [[83, "timing-performance-for-core-multiply-add"]], "Tips for building the site locally": [[1, "tips-for-building-the-site-locally"]], "Transparency of Models and Data": [[29, "transparency-of-models-and-data"]], "Trust your intuition": [[74, "trust-your-intuition"]], "Try preprocessing the dataset to make it work better": [[87, "try-preprocessing-the-dataset-to-make-it-work-better"]], "Tutorial Recording": [[40, "tutorial-recording"]], "Tutorial Seminar Series": [[16, "tutorial-seminar-series"]], "Tutorials": [[89, "tutorials"], [91, "tutorials"]], "UXarray": [[92, "uxarray"]], "Understanding the Directory Structure": [[28, "understanding-the-directory-structure"]], "Understanding the references dictionary": [[86, "understanding-the-references-dictionary"]], "Usability of Tools": [[29, "usability-of-tools"]], "Use ecgtools to build the catalog": [[41, "use-ecgtools-to-build-the-catalog"]], "Use the Intake-ESM Catalog to Access the Data": [[46, "use-the-intake-esm-catalog-to-access-the-data"]], "Use the catalog to read in data": [[28, "use-the-catalog-to-read-in-data"]], "Using Dask on the New Casper PBS Scheduler": [[22, "using-dask-on-the-new-casper-pbs-scheduler"]], "Using Graphviz in a Jupyter Notebook": [[36, "using-graphviz-in-a-jupyter-notebook"]], "Using Intake-ESM to Analyze Data from CESM2-LE": [[37, "using-intake-esm-to-analyze-data-from-cesm2-le"]], "Using Intake-ESM\u2019s New Derived Variable Functionality": [[38, "using-intake-esm-s-new-derived-variable-functionality"]], "Using conda on NSF NCAR HPC resources": [[7, "using-conda-on-nsf-ncar-hpc-resources"]], "Using datatree": [[86, "using-datatree"]], "Using our Configuration File in the Notebooks": [[44, "using-our-configuration-file-in-the-notebooks"]], "Using the Catalog": [[28, "using-the-catalog"], [37, "using-the-catalog"]], "Using xarray.apply_ufunc": [[80, "using-xarray-apply-ufunc"]], "Utilities": [[86, "utilities"]], "Values": [[2, "values"]], "View the Book on Github": [[50, "view-the-book-on-github"]], "Virtual aggregate CESM MOM6 datasets with kerchunk": [[86, "virtual-aggregate-cesm-mom6-datasets-with-kerchunk"]], "Vision": [[2, "vision"]], "Visualize": [[72, "visualize"], [83, "visualize"], [83, "id3"], [83, "id5"], [83, "id7"], [83, "id8"]], "Visualize the Catalog": [[50, "visualize-the-catalog"]], "Visualize the Comparisons": [[20, "visualize-the-comparisons"]], "Visualize the Output": [[47, "visualize-the-output"]], "Want to Create a New Appointment Type?": [[88, "want-to-create-a-new-appointment-type"]], "We are Xdev!": [[10, "we-are-xdev"]], "What Diagnostic Package(s) do you Use?": [[24, "what-diagnostic-package-s-do-you-use"]], "What I\u2019ve learned about debugging": [[74, "what-ive-learned-about-debugging"]], "What do I do if my question is not answered on this page?": [[7, "what-do-i-do-if-my-question-is-not-answered-on-this-page"]], "What exactly is xwrf?": [[67, "what-exactly-is-xwrf"]], "What features do you think are required before you would use new diagnostic packages?": [[24, "what-features-do-you-think-are-required-before-you-would-use-new-diagnostic-packages"]], "What is Papermill?": [[71, "what-is-papermill"]], "What is a sparse array?": [[80, "what-is-a-sparse-array"]], "What is a \u201cDerived Variable\u201d": [[38, "what-is-a-derived-variable"]], "What is kerchunk?": [[86, "what-is-kerchunk"]], "What we learned": [[81, "what-we-learned"]], "What\u2019s a \u201chistory\u201d file?": [[28, "what-s-a-history-file"]], "Where can I find Xarray tutorials?": [[7, "where-can-i-find-xarray-tutorials"]], "Where do I go for help?": [[7, "where-do-i-go-for-help"]], "Why Jupyter": [[44, "why-jupyter"]], "Why would I want a DOI?": [[64, "why-would-i-want-a-doi"]], "Work in Progress Talks": [[32, "work-in-progress-talks"]], "Workflow Examples": [[32, "workflow-examples"]], "Wrap it Up into a Function": [[68, "wrap-it-up-into-a-function"]], "Wrap it up": [[72, "wrap-it-up"]], "Wrapping into a Function and Using as a Preprocessor": [[65, "wrapping-into-a-function-and-using-as-a-preprocessor"]], "Wrapping sparse arrays in xarray": [[80, "wrapping-sparse-arrays-in-xarray"]], "Write the dataset to disk": [[43, "write-the-dataset-to-disk"]], "Writing multiple netCDF files in parallel with xarray and dask": [[17, "writing-multiple-netcdf-files-in-parallel-with-xarray-and-dask"]], "Writing to files in parallel": [[7, "writing-to-files-in-parallel"]], "Xarray + Dask Best Practices": [[62, "xarray-dask-best-practices"]], "Xarray Questions": [[30, "xarray-questions"], [31, "xarray-questions"]], "Xarray Tutorial": [[66, "xarray-tutorial"]], "Xarray Tutorial (09 and 23 June 2021)": [[32, "xarray-tutorial-09-and-23-june-2021"]], "Xarray User Forum + Updates": [[25, "xarray-user-forum-updates"]], "Xarray User Forum Talk Links": [[25, "xarray-user-forum-talk-links"]], "Xarray and Dask": [[7, "xarray-and-dask"]], "Xarray with GPUs": [[89, "xarray-with-gpus"]], "Xarray: Friendly, Interactive, and Scalable Scientific Data Analysis": [[89, "xarray-friendly-interactive-and-scalable-scientific-data-analysis"]], "Xdev Updates": [[30, "xdev-updates"], [31, "xdev-updates"]], "Your First Package Python Tutorial FAQ": [[69, "your-first-package-python-tutorial-faq"]], "Zen of Scientific Computing": [[4, "zen-of-scientific-computing"]], "Zulip": [[6, "zulip"]], "\u201cThinking with Xarray\u201d Tutorial": [[70, "thinking-with-xarray-tutorial"]]}, "docnames": ["CONTRIBUTING", "README", "about", "accessibility", "best-practices", "blog", "communication", "faq", "index", "office-hours", "posts/2019/we-are-xdev", "posts/2020/Time", "posts/2020/python-tutorial-faq", "posts/2020/python-tutorial-faq-part-2", "posts/2020/python-tutorial-faq-part-3", "posts/2020/templating-isnt-just-for-web-developers", "posts/2020/tutorial-seminar-series", "posts/2020/writing-multiple-netcdf-files-in-parallel-with-xarray-and-dask", "posts/2021/Interactive_Dashboard", "posts/2021/advanced-plotting-tutorial", "posts/2021/benchmarking-history-timeseries-intake", "posts/2021/cartopy-tutorial", "posts/2021/casper_pbs_dask", "posts/2021/cesm-datashader", "posts/2021/cesm-workshop-2021-diagnostics", "posts/2021/dask-summit-takeaway", "posts/2021/dask-tutorial", "posts/2021/dask-tutorial-update", "posts/2021/ecgtools-history-files-example", "posts/2021/esds-blog", "posts/2021/esds-update-november-2021", "posts/2021/esds-update-october-2021", "posts/2021/esds-update-september-2021", "posts/2021/geocat-comp-tutorial", "posts/2021/geocat-tutorial", "posts/2021/git-and-github-tutorial", "posts/2021/graphviz_example", "posts/2021/intake-cesm2-le-glade-example", "posts/2021/intake-esm-derived-variables", "posts/2021/intake-esm-holoviews-diagnostics", "posts/2021/intake-esm-tutorial-2021", "posts/2021/intake-obs-cesm2le-comparison", "posts/2021/intake_cmip6_debug", "posts/2021/intake_esm_dask", "posts/2021/jupyter-based-diagnostics-overview", "posts/2021/jupyter-notebooks-faq", "posts/2021/kay-et-al-cesm2-le", "posts/2021/map_blocks_example", "posts/2021/matplotlib-faq", "posts/2021/matplotlib-tutorial", "posts/2021/model_documentation_jupyterbook", "posts/2021/multiple_index_xarray_xoak", "posts/2021/ncar-jobqueue-example", "posts/2021/numpy-faq", "posts/2021/numpy-tutorial", "posts/2021/object-oriented-programming-tutorial", "posts/2021/oop-tutorial", "posts/2021/paired_programming_vs", "posts/2021/pandas-tutorial", "posts/2021/project-pythia-overview", "posts/2021/python-tutorial-seminar-series-spring-2021", "posts/2021/regrid-observations-pop-grid", "posts/2021/scaling-with-dask-class-takeaways", "posts/2021/scipy-2021-takeaways", "posts/2021/software-citation", "posts/2021/weather-station-data-preprocess", "posts/2021/xarray-tutorial", "posts/2021/xarray-wrf-example", "posts/2021/yearly-averages-xarray", "posts/2021/your-first-package-python-tutorial-faq", "posts/2022/Thinking-with-Xarray", "posts/2022/batch-processing-notebooks-with-papermill", "posts/2022/cam-se-regridding", "posts/2022/dask-debug-detrend", "posts/2022/debugging", "posts/2022/esds-event-prep", "posts/2022/esds-event-recap", "posts/2022/esds-fall-event", "posts/2022/metpy_tutorial", "posts/2022/office-hours-appointments", "posts/2022/sparse-PFT-gridding", "posts/2022/xarray-groupby-vs-geocat-climatology", "posts/2022/yourfirst", "posts/2023/cam-se-analysis", "posts/2023/cesm2-le-timeseries-kerchunk", "posts/2023/esds-annual-event", "posts/2023/kerchunk-mom6", "posts/2023/mfdataset", "posts/2023/office-hours-help", "posts/2023/scipy23", "posts/2023/unstructured-grid-collab-1", "posts/2024/esds-annual-event-recap", "projects"], "envversion": {"sphinx": 61, "sphinx.domains.c": 3, "sphinx.domains.changeset": 1, "sphinx.domains.citation": 1, "sphinx.domains.cpp": 9, "sphinx.domains.index": 1, "sphinx.domains.javascript": 3, "sphinx.domains.math": 2, "sphinx.domains.python": 4, "sphinx.domains.rst": 2, "sphinx.domains.std": 2}, "filenames": ["CONTRIBUTING.md", "README.md", "about.md", "accessibility.md", "best-practices.md", "blog.md", "communication.md", "faq.md", "index.md", "office-hours.md", "posts/2019/we-are-xdev.md", "posts/2020/Time.ipynb", "posts/2020/python-tutorial-faq.md", "posts/2020/python-tutorial-faq-part-2.md", "posts/2020/python-tutorial-faq-part-3.md", "posts/2020/templating-isnt-just-for-web-developers.md", "posts/2020/tutorial-seminar-series.md", "posts/2020/writing-multiple-netcdf-files-in-parallel-with-xarray-and-dask.ipynb", "posts/2021/Interactive_Dashboard.md", "posts/2021/advanced-plotting-tutorial.md", "posts/2021/benchmarking-history-timeseries-intake.ipynb", "posts/2021/cartopy-tutorial.md", "posts/2021/casper_pbs_dask.md", "posts/2021/cesm-datashader.ipynb", "posts/2021/cesm-workshop-2021-diagnostics.md", "posts/2021/dask-summit-takeaway.md", "posts/2021/dask-tutorial.md", "posts/2021/dask-tutorial-update.md", "posts/2021/ecgtools-history-files-example.ipynb", "posts/2021/esds-blog.md", "posts/2021/esds-update-november-2021.md", "posts/2021/esds-update-october-2021.md", "posts/2021/esds-update-september-2021.md", "posts/2021/geocat-comp-tutorial.md", "posts/2021/geocat-tutorial.md", "posts/2021/git-and-github-tutorial.md", "posts/2021/graphviz_example.ipynb", "posts/2021/intake-cesm2-le-glade-example.ipynb", "posts/2021/intake-esm-derived-variables.ipynb", "posts/2021/intake-esm-holoviews-diagnostics.ipynb", "posts/2021/intake-esm-tutorial-2021.md", "posts/2021/intake-obs-cesm2le-comparison.ipynb", "posts/2021/intake_cmip6_debug.md", "posts/2021/intake_esm_dask.md", "posts/2021/jupyter-based-diagnostics-overview.ipynb", "posts/2021/jupyter-notebooks-faq.md", "posts/2021/kay-et-al-cesm2-le.ipynb", "posts/2021/map_blocks_example.md", "posts/2021/matplotlib-faq.md", "posts/2021/matplotlib-tutorial.md", "posts/2021/model_documentation_jupyterbook.ipynb", "posts/2021/multiple_index_xarray_xoak.md", "posts/2021/ncar-jobqueue-example.md", "posts/2021/numpy-faq.md", "posts/2021/numpy-tutorial.md", "posts/2021/object-oriented-programming-tutorial.md", "posts/2021/oop-tutorial.md", "posts/2021/paired_programming_vs.md", "posts/2021/pandas-tutorial.md", "posts/2021/project-pythia-overview.md", "posts/2021/python-tutorial-seminar-series-spring-2021.md", "posts/2021/regrid-observations-pop-grid.ipynb", "posts/2021/scaling-with-dask-class-takeaways.md", "posts/2021/scipy-2021-takeaways.md", "posts/2021/software-citation.md", "posts/2021/weather-station-data-preprocess.ipynb", "posts/2021/xarray-tutorial.md", "posts/2021/xarray-wrf-example.ipynb", "posts/2021/yearly-averages-xarray.ipynb", "posts/2021/your-first-package-python-tutorial-faq.md", "posts/2022/Thinking-with-Xarray.md", "posts/2022/batch-processing-notebooks-with-papermill.md", "posts/2022/cam-se-regridding.ipynb", "posts/2022/dask-debug-detrend.ipynb", "posts/2022/debugging.md", "posts/2022/esds-event-prep.md", "posts/2022/esds-event-recap.md", "posts/2022/esds-fall-event.md", "posts/2022/metpy_tutorial.md", "posts/2022/office-hours-appointments.md", "posts/2022/sparse-PFT-gridding.ipynb", "posts/2022/xarray-groupby-vs-geocat-climatology.ipynb", "posts/2022/yourfirst.md", "posts/2023/cam-se-analysis.ipynb", "posts/2023/cesm2-le-timeseries-kerchunk.ipynb", "posts/2023/esds-annual-event.md", "posts/2023/kerchunk-mom6.ipynb", "posts/2023/mfdataset.ipynb", "posts/2023/office-hours-help.md", "posts/2023/scipy23.md", "posts/2023/unstructured-grid-collab-1.md", "posts/2024/esds-annual-event-recap.md", "projects.md"], "indexentries": {}, "objects": {}, "objnames": {}, "objtypes": {}, "terms": {"": [0, 2, 6, 7, 8, 10, 12, 14, 15, 17, 19, 20, 21, 23, 25, 26, 27, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 46, 47, 49, 50, 51, 52, 53, 55, 56, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 71, 72, 74, 75, 77, 78, 80, 83, 84, 85, 86, 87, 88, 89], "0": [7, 8, 11, 13, 14, 17, 18, 20, 23, 28, 30, 36, 38, 39, 41, 43, 46, 47, 50, 51, 63, 65, 67, 68, 71, 72, 73, 80, 81, 83, 84, 86, 87], "00": [7, 11, 17, 20, 22, 23, 28, 36, 37, 38, 39, 41, 43, 46, 51, 52, 61, 65, 67, 68, 71, 72, 73, 77, 80, 81, 83, 84, 86, 87], "000": [46, 63], "0000": [46, 81], "00000": [23, 28, 38, 72, 84, 87], "000000000": [11, 46, 65, 67, 81], "0000000200408773e": 86, "000000e": [39, 41, 61, 68, 72, 80, 83], "0000089": 39, "00000valid_max": 41, "00001259": 39, "00001293": 39, "00001324": 39, "0000e": 86, "0001": [18, 20, 28, 86], "000101": 28, "000152": 41, "0001523": 41, "0002": [18, 28], "00025932e": 73, "0003": [18, 28], "0004": 28, "0004569": 41, "000457": 41, "000761": 41, "0007613": 41, "000832": 81, "000arrai": 41, "000e": [61, 72, 86], "000valid_max": 41, "001": [61, 84, 87], "001012": 28, "001065": 41, "001369": 41, "001673": 41, "001976": 41, "001_hfreq": 61, "001host": 84, "001intake_esm_dataset_kei": 61, "001lognam": [84, 87], "001xarrai": 61, "002": [39, 44, 72, 87], "0021": [23, 51], "002101": 23, "0021148": 81, "002278": 41, "0024": 61, "002497": 81, "00255": [8, 46], "00258": 41, "002881": 41, "002content": 39, "002titl": 72, "002xarrai": 39, "003": [18, 23, 51, 72, 83, 87], "003181": 41, "00344152e": 73, "00348": 41, "00365299": 81, "003778": 41, "003titl": 83, "004": [18, 39, 44, 86, 87], "004074": 41, "004168": 81, "00437": 41, "0046": 86, "004664": 41, "0049": 61, "004957": 41, "004_copy2": 44, "004e": 72, "005": [20, 87], "005236": 46, "005248": 41, "005538": 41, "00574897e": 73, "005826": 41, "006": [41, 87], "006112": 41, "006397": 41, "006679": 41, "006959": 41, "007": 87, "0070": 86, "0071": 86, "007238": 41, "007498": 81, "007514": 41, "0077": 41, "007788": 41, "00782921": 81, "008": 87, "008059": 41, "0081": 39, "00832280420835": 86, "008328": 41, "008594": 41, "008858": 41, "009": 87, "009119": 41, "00916852": 81, "009378": 41, "009633": 41, "009886": 41, "00_build_catalog": 44, "00arrai": 65, "00avg_period": [46, 81], "00axi": 61, "00bound": 46, "00intake_esm_attr": 38, "00intake_esm_dataset_kei": 38, "00long_nam": [17, 23, 80, 83], "00prev_avg_period": 81, "00standard_nam": [46, 81], "00west": 67, "00xarrai": 68, "01": [7, 8, 11, 17, 18, 20, 23, 28, 30, 36, 38, 39, 41, 46, 51, 61, 65, 68, 72, 73, 80, 81, 83, 84, 86, 87], "010": 87, "0100": 39, "010135": 41, "010381": 41, "010471": [38, 41, 46, 80, 84, 87], "010625": 41, "010865": 41, "011": [7, 87], "011102": 41, "011335": 41, "011565": 41, "011791": 41, "011e": 65, "011lognam": 87, "012": 87, "012014": 41, "012233": 41, "012448": 41, "01245054602623": [72, 83], "012451": [38, 46, 72, 83], "01266": 41, "012868": 41, "013": 87, "013072": 41, "013271": 41, "013467": 41, "01365061591797": 86, "013651": 86, "013659": 41, "013846": 41, "013e": 65, "014": 87, "01403": 41, "014209": 41, "014384": 41, "014554": 41, "01472": 41, "014881": 41, "015": [37, 87], "015038": 41, "01519": 41, "015338": 41, "015481": 41, "015619": 41, "015705": [38, 80], "015707": [41, 46, 84, 87], "015753": 41, "015882": 41, "016": [67, 87], "016006": 41, "016125": 41, "016239": 41, "016348": 41, "016452": 41, "016551": 41, "016645": 41, "016734": 41, "016818": 41, "016897": 41, "016971": 41, "017": 87, "017039": 41, "017103": 41, "017161": 41, "017214": 41, "017261": 41, "017304": 41, "017341": 41, "017373": 41, "017399": 41, "017421": 41, "017436": 41, "017447": 41, "017452": 41, "018": 87, "01881800963099": 86, "019": 87, "01_0001": 18, "01_0002": 18, "01_0003": 18, "01_0004": 18, "01_compute_20yr_mean": 44, "01arrai": 81, "01long_nam": [46, 81], "01t00": [46, 65, 67, 81], "01t03": 67, "01t06": 67, "01t09": 67, "01t12": [46, 67], "01t15": 67, "01t18": [11, 67], "01t21": 67, "01t23": 65, "01time_coverage_end": 61, "02": [7, 8, 17, 20, 22, 23, 32, 39, 41, 43, 46, 47, 51, 52, 61, 67, 68, 72, 78, 80, 81, 83, 84, 86, 87], "020": 87, "0202489197254": [72, 83, 84], "020249": [38, 41, 46, 72, 83, 84], "020942": 46, "023902202736755744read": 80, "024989565144135036read": 80, "02503": 72, "02607227e": 73, "026178": 46, "026667": 81, "02718": 41, "02750949e": 73, "02758525e": 73, "02760897": 39, "02962": 41, "02d": 61, "02t00": 67, "02t03": 67, "02t06": 67, "02t09": 67, "02t12": [46, 67], "02t15": 67, "02t18": [11, 67], "02t21": 67, "03": [8, 17, 20, 28, 39, 41, 46, 47, 61, 65, 67, 68, 71, 72, 73, 81, 83, 84, 86, 87], "030000e": 80, "031414": [38, 41, 46, 80, 84, 87], "031691864132881": [72, 83, 84], "031692": [46, 72, 83, 84], "032": [46, 72, 83, 84], "03210576e": 73, "035002": 81, "03503042e": 73, "03647573e": 73, "036649": [41, 46, 84, 87], "03665": 80, "036652": [38, 80], "0368": 20, "03883591": 81, "03arrai": [61, 65, 72, 83], "03cartesian_axi": 86, "03formula_term": [46, 84], "03long_nam": [72, 83, 84], "03standard_nam": 61, "03t00": 67, "03t03": 67, "03t06": 67, "03t09": 67, "03t12": [46, 67], "03t15": 67, "03t18": [11, 67], "03t21": 67, "04": [8, 17, 20, 32, 39, 46, 61, 65, 67, 68, 72, 80, 81, 84, 86, 87], "041885": 46, "04267883": 83, "043": 41, "04348": 41, "04451493": 81, "04697": 41, "04712": 46, "0489": 41, "049": 41, "04971": 41, "04arrai": [65, 72], "04long_nam": 72, "04t00": 67, "04t03": 67, "04t06": 67, "04t09": 67, "04t12": 67, "04t15": 67, "04t18": 67, "04t21": 67, "04xarrai": 65, "05": [8, 17, 20, 28, 39, 41, 61, 65, 67, 68, 71, 73, 77, 80, 81, 84, 86, 87], "050000e": [39, 61, 68], "050112": 23, "05013439e": 73, "0502": 51, "05055": 41, "05097856e": 73, "050e": [72, 86], "051192e": [39, 61, 68], "05142": 41, "05226": 41, "052356": [41, 46, 84, 87], "052357": [38, 80], "05318": 41, "05756495e": 73, "05759162303664": [84, 87], "057592": [41, 46, 84, 87], "057594": [38, 80], "05789642": 37, "05arrai": 61, "05cell": 71, "05long_nam": [39, 61, 68], "05standard_nam": 61, "05t00": 67, "05t03": 67, "05t06": 67, "05t09": 67, "05t12": 67, "05t15": 67, "05t18": 67, "05t21": 67, "06": [8, 17, 20, 32, 38, 39, 41, 46, 61, 67, 71, 72, 73, 80, 81, 83, 84, 86, 87], "060000e": 80, "06090852": 83, "061279296875": [72, 83], "0620308e": 46, "0625": [72, 83], "0625e": 86, "0625valid_min": 61, "062827": 46, "064165": 81, "06641072": 83, "068063": [38, 41, 46, 80, 84, 87], "06arrai": 61, "06read": 83, "06t00": 67, "06t03": 67, "06t06": 67, "06t09": 67, "06t12": 67, "06t15": 67, "06t18": 67, "06t21": 67, "07": [8, 17, 28, 39, 46, 61, 67, 73, 81, 84, 86, 87], "07189739": 83, "073298": [41, 46, 84, 87], "073299": [38, 80], "0733": 80, "075633e": [39, 61, 68], "07664777": 81, "07671": 68, "07671233": 68, "07699458733379": 86, "076995": 86, "07736837": 83, "077a": 41, "07852571": 83, "078534": 46, "07966716": 83, "07arrai": [46, 67], "07cell_method": 46, "07t00": 67, "07xarrai": 67, "08": [8, 17, 20, 23, 28, 39, 41, 46, 61, 67, 72, 73, 75, 77, 81, 83, 84, 86, 87], "080000e": 80, "08163473": 39, "08209887026972625read": 80, "08219": 68, "08219178": 68, "08377": 46, "08493": 68, "08493151": 68, "08493arrai": 68, "086": 67, "08781827223608": 86, "087846e": [39, 61, 68], "089005": [38, 41, 46, 80, 84, 87], "08950491": 81, "09": [8, 17, 20, 28, 39, 61, 65, 67, 75, 77, 78, 80, 81, 83, 84, 86, 87], "0925": 81, "093948": 41, "094238": [38, 80], "09424": 80, "094241": [41, 46, 84, 87], "094976": 41, "09541132": 81, "09546": 65, "097114e": [39, 61, 68], "097156": 39, "098333": 81, "099476": 46, "09arrai": 65, "0arrai": [39, 41, 61, 65, 68, 72, 73, 80, 83], "0axi": 38, "0bcacd1c": 38, "0bound": 84, "0cartesian_axi": 86, "0case": 84, "0comment": [46, 61], "0coordin": 83, "0corner_lat": 67, "0dataset_titl": 46, "0dy": 67, "0dyn_opt": 67, "0fill_valu": 41, "0flag_soil_lay": 67, "0geospatial_lat_max": 61, "0geospatial_lat_unit": 61, "0geospatial_lon_max": 61, "0geospatial_lon_min": 61, "0geospatial_vertical_max": 61, "0geospatial_vertical_min": 61, "0histori": 80, "0intake_esm_attr": 38, "0inverse_flatten": 61, "0licens": 61, "0long_nam": [39, 41, 46, 72, 80, 84], "0m": 28, "0mbuilder": 28, "0mdepth": 28, "0mdirectorypath": 28, "0mexclude_pattern": 28, "0mextens": 28, "0mint": 28, "0mlist": 28, "0mnjob": 28, "0moad_cen_lat": 67, "0mpydant": 28, "0mroot_path": 28, "0mstr": 28, "0mtype": 28, "0nco": 38, "0pole_lat": 67, "0pole_lon": 67, "0r": [72, 83], "0rxarrai": [72, 83], "0semi_major_axi": 61, "0sourc": [23, 72, 83, 84, 87], "0standard_nam": 87, "0th": 13, "0truelat1": 67, "0truelat2": 67, "0valid_max": [39, 61], "0valid_min": 68, "0x2ae53e497a90": 80, "0x2ae53eaa7220": 80, "0x2ae53eaa77c0": 80, "0x2ae53f25af40": 80, "0x2ae53fb0d7f0": 80, "0x2ae53fc79bb0": 80, "0x2ae53fd9dca0": 80, "0x2ae53fedf640": 80, "0x2ae55c00f850": 80, "0x2b1c86b5f2e0": 61, "0x2b1c89523a00": 61, "0x2b84d46c84c0": 38, "0x2ba103a57eb0": 39, "0x7fd46e54acd0": 73, "0xarrai": 83, "1": [0, 6, 7, 8, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21, 22, 23, 26, 27, 28, 30, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 46, 47, 49, 50, 51, 52, 54, 55, 56, 58, 60, 61, 62, 63, 65, 66, 67, 68, 70, 72, 73, 75, 76, 77, 78, 80, 81, 82, 84, 86, 87, 90], "10": [7, 8, 12, 13, 16, 17, 18, 20, 28, 30, 31, 37, 38, 39, 41, 43, 46, 47, 60, 61, 63, 65, 67, 68, 72, 73, 76, 77, 80, 81, 83, 84, 86, 87], "100": [7, 8, 28, 29, 37, 38, 39, 41, 43, 46, 61, 63, 67, 68, 71, 72, 73, 80, 86], "1000": [37, 38, 41, 46, 61, 67, 72, 83, 84], "10000": 61, "100000": [61, 67], "1000e": 86, "1001": [41, 84], "1004": 72, "10090386867523": [72, 83, 84], "100904": [38, 41, 46, 72, 83, 84], "100e": 72, "100m": [43, 87], "100mb": 87, "101": [38, 41], "1011": [65, 87], "1013": 65, "1015707326662": 86, "101763": 67, "101890": 67, "101914": 67, "101925": 67, "101949": 67, "101986": 67, "102": [38, 46, 80], "102007": 67, "102015": 67, "102018": 67, "102028": 67, "102046": 67, "102048": 67, "102049": 67, "102067": 67, "102096": 67, "102118": 67, "102203": 67, "102205": 67, "102211": 67, "102215": 67, "102241": 67, "102274": 67, "102282": 67, "102318": 67, "102340": 67, "102343": 67, "102351": 67, "102359": 67, "102362": 67, "102373": 67, "102379": 67, "102404": 67, "102449": 67, "102484": 67, "102487": 67, "102488": 67, "102492": 67, "102496": 67, "1025": 61, "102534": 67, "102537": 67, "102549": 67, "102578": 67, "102613": 67, "102618": 67, "102629": 67, "102644": 67, "102648": 67, "102663": 67, "102679": 67, "102686": 67, "102695": 67, "102698": 67, "102737": 67, "102752": 67, "102769": 67, "102777": 67, "102788": 67, "102820": 67, "10282701e": 73, "1028296": 86, "102835": 67, "102858": 67, "102877": 67, "102894": 67, "102934": 67, "102951": 67, "102952": 67, "102977": 67, "102982": 67, "102992": 67, "102k": 71, "103": [38, 41, 46, 72, 83, 84], "103004": 67, "103012": 67, "103014": 67, "103026": 67, "103027": 67, "103036": 67, "103038": 67, "103042": 67, "103049": 67, "103085": 67, "1031": 87, "10311168e": 73, "103122": 67, "1032": [7, 37], "10320": 72, "104": 38, "104414": 80, "104614": 41, "104712": 46, "104memoryord": 67, "105": [37, 38, 41, 65], "1050": 61, "105000": 61, "1051": 87, "105arrai": 38, "105k": 71, "106": 41, "106204e": [39, 61, 68], "107": [46, 67], "1071": 87, "1072": 20, "1075": 61, "10763635e": 73, "108": [41, 87], "10800": 72, "1089941": 81, "1091": 87, "10921096": 86, "10970": 46, "109947": [38, 80], "109948": [41, 46, 84, 87], "10am": 77, "10b0k7vx": 37, "10cft_barlei": 80, "10gb": [17, 22, 52], "10levdcmp": 80, "10th": [8, 13, 54, 56, 75, 77], "10z": 80, "11": [7, 8, 13, 15, 16, 17, 20, 23, 28, 36, 37, 38, 39, 41, 46, 61, 65, 68, 72, 76, 77, 80, 81, 83, 84, 86, 87], "110": [41, 81], "1100": 61, "110000": 61, "11025": 81, "111": [37, 46, 72, 83, 84], "11103": 39, "1111": 87, "111429": 80, "111429pft": 80, "11167": 81, "112": [41, 46, 61, 72, 83], "11219": [46, 72, 83, 84], "112190246582": [72, 83, 84], "1125": 61, "11280": 72, "1128696": 61, "113": [38, 67], "1131": 87, "114": [41, 72, 83], "1140": 38, "1140lev": 38, "11449891328812": 84, "114499": 84, "115": 83, "1150": 61, "115000": 61, "1151": 87, "11518": 80, "115181": [38, 80], "115183": [41, 46, 84, 87], "1151832460733": [84, 87], "1152": [72, 83], "1152coordin": 83, "1152cosp_scol": 72, "1152lat": 83, "1152ncol": 83, "1152time": 72, "116": [41, 83], "117": 46, "1171": 87, "117216": [46, 72, 83, 84], "11721634864807": [72, 83, 84], "1175": [8, 46, 61], "11760": 72, "118": 41, "11881845": 81, "119": 41, "1191": 87, "11910376": 86, "11am": 77, "11cft_irrigated_barlei": 80, "11eb": 37, "11ec": [38, 41, 46, 61, 67, 68, 73], "11ed": [84, 86], "11ee": [83, 87], "11th": [8, 26, 27, 75, 77], "12": [7, 8, 11, 17, 18, 20, 23, 28, 36, 37, 38, 39, 41, 46, 51, 60, 61, 65, 67, 68, 72, 73, 77, 80, 81, 83, 84, 86, 87], "120": [23, 41, 51, 67, 72, 80, 83], "1200": [61, 72], "12000": 67, "120000": 61, "120419": 46, "120convent": [23, 72, 83], "121": [38, 41, 46, 72, 83, 84], "121664": 81, "122": 46, "12240": 72, "1225": 61, "12255859375": [72, 83], "1226": 67, "123": 41, "12309913e": 73, "1231": [37, 87], "1234": 15, "12345": 15, "1240": 61, "1243": 41, "124517cf72a30883d5a3c70220985aeeivt": 72, "125": [41, 46, 61, 67, 72, 80, 83], "1250": 61, "12500": 61, "125000": 61, "125000e": [72, 83], "12500894": 39, "125028e": [39, 61, 68], "1250e": 86, "1251": [37, 87], "125654": [38, 41, 46, 80, 84, 87], "125768e": [39, 61, 68], "125e": [28, 39, 68, 86], "126": 41, "127": [17, 41, 46, 73, 86], "12720": 72, "1275": 61, "12784": 11, "128": 84, "1280": 61, "1281": [37, 87], "12899656": 86, "129": 41, "12arrai": 61, "12cft_winter_barlei": 80, "12th": [8, 35], "12z": 67, "12z_t": 61, "13": [7, 8, 17, 20, 23, 32, 37, 38, 41, 46, 51, 61, 65, 67, 72, 73, 77, 80, 81, 83, 84, 86, 87], "130": 28, "1300": 61, "130000": 61, "1301": [37, 87], "13089": [38, 41, 46, 80, 84, 87], "131": [41, 46, 72, 83, 84], "132": [46, 67], "13200": 72, "13249928": 81, "1325": 61, "132z": 67, "133": 41, "133405e": [39, 61, 68], "13371148": 81, "135": [41, 81], "1350": 61, "135000": 61, "13527": 41, "136": [41, 87], "136126": 46, "13680": 72, "137": [46, 61], "1375": 61, "1378": 20, "138": 41, "13888936": 86, "139351": 41, "13997774668711": 86, "139978": 86, "13cft_irrigated_winter_barlei": 80, "13isoilwat": 67, "13lat": 41, "14": [8, 16, 17, 23, 31, 37, 38, 41, 46, 60, 65, 67, 71, 72, 77, 80, 81, 83, 84, 86, 87], "140": 41, "1400": 61, "140000": 61, "14059230e": 73, "1411": 65, "141361": 46, "14160": 72, "142": [38, 41, 46, 72, 83, 84, 86], "14225": 41, "1425": 61, "14384": 41, "144": 41, "1440": 61, "1440depth": 61, "1440nbound": 61, "1447": 28, "145": 67, "1450": 61, "145000": 61, "146": [41, 83], "1460": 84, "14600": 72, "14600coordin": 72, "14600lat": 72, "14600lev": 72, "14600ncol": 72, "14640": 72, "146597": [38, 41, 46, 80, 84, 87], "147": [41, 46], "1475": 61, "1476": 68, "148": [41, 72, 83], "1480550400": 65, "148336": 81, "14878216": 86, "149": 41, "1499288082123": 84, "14992880821234": [72, 83], "149929": [46, 72, 83, 84], "14cft_rye": 80, "14grid_id": 67, "14th": [8, 16, 26, 55], "15": [7, 8, 17, 20, 28, 32, 37, 38, 41, 46, 61, 65, 68, 71, 72, 77, 80, 81, 83, 84, 86, 87], "150": [41, 61], "1500": 61, "15000": 61, "150000": 61, "150000e": [39, 61, 68], "150e": [72, 86], "151": [41, 87], "15120": 72, "15183": 80, "151832": [41, 46, 84, 87], "151833": [38, 80], "152": [28, 46], "15208992": 39, "15217317": 81, "15285272": 81, "153": [41, 46], "15362": 38, "154": [46, 72, 83, 84], "1543505128": 46, "1543508400": 46, "155": [41, 81], "15524177e": 73, "1553762": 23, "15548862": 81, "15600": 72, "15642686824839": 86, "157": [41, 46], "157068": 46, "15752314e": 73, "157947": [46, 72, 83, 84], "15794742852449": [72, 83, 84], "15831": 41, "158333": 81, "15844975e": 73, "15867496": 86, "159": 41, "15cft_irrigated_ry": 80, "15cosp_sza": 72, "15isurban": 67, "15time": 72, "16": [7, 8, 17, 36, 37, 38, 40, 41, 46, 47, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "160": [20, 38, 68, 80, 84], "16080": 72, "161": 41, "162": [46, 61], "162304": 46, "163": 41, "164": [67, 80], "16426": 84, "16426coordin": 84, "16426lev": 84, "165": 41, "16560": 72, "166": [41, 80], "166408": 80, "1664080": 80, "1664081": 80, "166408dask": 80, "166408time": 80, "167": [46, 61], "167498": 81, "167538": [38, 80], "167539": [41, 46, 84, 87], "168": [38, 41, 46, 68, 72, 83, 84], "1680": 72, "16856776": 86, "16895": 41, "169": 67, "16928": 41, "1697": 41, "16_1981": 17, "16_1982": 17, "16_1983": 17, "16cft_winter_ry": 80, "16z": 67, "17": [8, 17, 20, 28, 32, 37, 38, 41, 46, 61, 63, 65, 72, 73, 80, 81, 83, 84, 87, 90], "170": 41, "1700": 80, "170001": 80, "1701": 41, "17040": 72, "1706": 41, "171": 61, "1711": 41, "172": [41, 46, 61], "1720": 20, "17207442": 39, "1721": 37, "17241696": 39, "17277486910994": [84, 87], "172775": [38, 41, 46, 80, 84, 87], "17365": 41, "174": 41, "175": 61, "17500": 61, "17520": [72, 83], "17522": 87, "176": [41, 67], "1764": 61, "1764z_t": 61, "17660861e": 73, "177": [46, 61], "178": [23, 41], "17801": 46, "17846056": 86, "179": [20, 41, 61], "17_00": 67, "17cft_irrigated_winter_ry": 80, "17islak": 67, "17min": 84, "18": [8, 17, 20, 31, 37, 38, 41, 46, 47, 67, 72, 80, 81, 83, 84, 87, 91], "180": [23, 28, 37, 41, 61, 63, 81], "18000": 72, "180mb": 87, "180time": 41, "181": [37, 41, 46, 72, 81, 83, 84], "181440": 67, "181818": 67, "181920": 67, "182": [81, 84, 87], "18202": 86, "182299": 67, "1825": 87, "18262": 46, "183": [41, 81], "183246": [38, 41, 46, 80, 84, 87], "184": [37, 81], "18480": 72, "185": [37, 41, 81], "1850": [8, 37, 46, 84, 85, 87], "18500101": [84, 87], "1851": 46, "1852": 46, "1853": 46, "1854": 46, "18591231": [84, 87], "18597561": 39, "18597562": 39, "186": [41, 80, 81], "1860": 41, "18600101": [84, 87], "186457e": [39, 61, 68], "1868": 37, "18691231": [84, 87], "187": [41, 61, 81], "18700101": [84, 87], "1875": [72, 83], "18750883": 39, "1875read": 80, "18776": 46, "18791231": [84, 87], "188": [41, 81], "18800101": [84, 87], "18835336": 86, "18848": [38, 80], "188482": [41, 46, 84, 87], "18891231": [84, 87], "189": [41, 81], "18900101": [84, 87], "189278": 41, "18933231": 39, "18960": 72, "18985": 41, "18991231": [84, 87], "18996016223117": 86, "18cft_cassava": 80, "18th": [8, 85], "19": [8, 20, 32, 37, 38, 39, 41, 46, 67, 68, 72, 73, 80, 81, 83, 84, 87], "190": [41, 81], "1900": [11, 62], "19000101": [84, 87], "190243": 41, "19091231": [84, 87], "191": [28, 41, 46, 81], "19100101": [84, 87], "19115standard_name_vocabulari": 61, "19191231": [84, 87], "191slon": 46, "192": [20, 37, 38, 41, 46, 72, 80, 81, 84, 87], "1920": [7, 36, 46, 72], "192001": [7, 72], "19200101": [84, 87], "1928184": 61, "19288036": 81, "1929": 72, "192912": 72, "19291231": [84, 87], "19296261e": 73, "192coordin": 87, "192ensembl": 87, "192gridcel": 80, "192lon": [38, 41, 46, 80, 84, 87], "193": [41, 81], "19300101": [84, 87], "193717": 46, "19375": [41, 84], "1937500834465": 84, "19391231": [84, 87], "194": 81, "19400101": [84, 87], "194912": 42, "19491231": [84, 87], "195": [41, 67, 81], "1950": 11, "19500101": [84, 87], "1954": 67, "1955": 61, "1958": 61, "19591231": [84, 87], "195e": 72, "196": [41, 81], "19600101": [84, 87], "19603941": 39, "1961": 46, "196312": 67, "1969": 18, "19691231": [84, 87], "197": [38, 41, 46, 72, 81, 83, 84], "1970": [65, 84], "19700101": [84, 87], "1979": [11, 17, 41], "19791231": [84, 87], "198": [41, 81], "1980": [17, 41], "19800101": [84, 87], "1980lev": 41, "1981": [17, 61], "1982": [17, 81], "1983": [17, 81], "198398": [38, 41, 46, 72, 83, 84], "1983984708786": [72, 83, 84], "1984": 81, "1985": 81, "1986": 81, "19891231": [84, 87], "198953": 46, "199": 81, "1990": 46, "19900101": [84, 87], "1993": 63, "1994": 17, "199844e": 80, "199912": 42, "19991231": [84, 87], "19cft_irrigated_cassava": 80, "19long_nam": 39, "19th": [8, 85, 91], "1arrai": [46, 65], "1bound": 72, "1cd0605d461b": 68, "1cft_c3_irrig": 80, "1coordin": [41, 61, 84], "1ctype_crop": 80, "1d": [25, 80], "1d915812": 38, "1depth": 61, "1descript": 67, "1dst_grid_rank": [72, 83], "1e": [41, 46, 61, 72, 83, 84], "1e2": 47, "1e9": [84, 87], "1ea82bb067c3273a6166d1b1f77d490f": 73, "1flag_canfra": 67, "1flag_clayfrac": 67, "1flag_erod": 67, "1flag_excluded_middl": 67, "1flag_frc_urb2d": 67, "1flag_imperv": 67, "1flag_lai12m": 67, "1flag_lake_depth": 67, "1flag_mf_xi": 67, "1flag_psfc": 67, "1flag_sandfrac": 67, "1flag_slp": 67, "1flag_sm000007": 67, "1flag_sm007028": 67, "1flag_sm028100": 67, "1flag_sm100289": 67, "1flag_snow": 67, "1flag_snowh": 67, "1flag_soilhgt": 67, "1flag_sst": 67, "1flag_st000007": 67, "1flag_st007028": 67, "1flag_st028100": 67, "1flag_st100289": 67, "1flag_urb_param": 67, "1flag_var_sso": 67, "1gwrko6h": 37, "1i_parent_end": 67, "1i_parent_start": 67, "1j_parent_start": 67, "1lev": 41, "1long_nam": 46, "1ltype_crop": 80, "1mminlu": 67, "1nbnd": 84, "1nc79fcf": 73, "1nco": 17, "1ncol": [23, 72], "1num_metgrid_level": 67, "1num_metgrid_soil_level": 67, "1p4": 20, "1parent_id": 67, "1pfts1d_gi": 80, "1pfts1d_itype_col": 80, "1pfts1d_jxy": 80, "1revision_id": 38, "1season": 41, "1south": 67, "1sr_x": 67, "1sr_y": 67, "1st": [11, 13], "1time": 41, "1unit": [38, 41, 84], "1v3": 61, "1v3_conserv": 61, "1vvvvvvgav": 86, "1west": 67, "1xarrai": 67, "1z_t": 61, "2": [6, 7, 8, 11, 12, 14, 17, 18, 20, 22, 23, 26, 27, 28, 30, 34, 36, 37, 38, 39, 41, 42, 43, 46, 47, 51, 52, 61, 63, 65, 66, 67, 68, 72, 76, 77, 80, 81, 84, 86, 87, 88, 90], "20": [8, 15, 20, 32, 37, 38, 41, 46, 61, 63, 65, 67, 68, 72, 80, 81, 83, 84, 86, 87], "200": [37, 41, 43, 61, 63, 72, 81, 83], "2000": [41, 61, 83, 87], "20000": 61, "20000101": [84, 87], "2000010100z": 83, "2000123121z": 83, "2000e": 86, "2001": [63, 83], "2002": 41, "2005": [7, 11, 36, 61], "200512": 7, "2006": [7, 36, 38, 41], "2006xarrai": 41, "2009": [8, 84], "20091231": [84, 87], "200m": 86, "200mb": 7, "201": 81, "2010": 61, "20100101": [84, 87], "2011": [67, 72], "2012": [46, 80], "2013": [11, 41], "2014": [41, 46, 84], "20140724": 41, "20140724xarrai": 41, "20141231": [84, 87], "2014institut": 41, "2015": [8, 31, 37, 63, 68, 84], "20150101": 87, "2016": [17, 65, 68], "20161201": 65, "2017": [46, 61, 67, 68], "2017576": 86, "2018": [10, 20, 46, 61, 68, 72, 80], "201812": 80, "2019": [8, 10, 40, 46, 61, 63, 68, 80], "2019arrai": 68, "2019xarrai": 68, "202": [41, 81, 83], "2020": [8, 15, 41, 46], "2021": [7, 8, 22, 23, 28, 37, 46, 61, 73, 83, 86], "2022": [7, 8, 72, 73, 76, 77, 78, 86], "2023": [0, 8, 83, 84, 86, 87, 90], "2024": 8, "20241231": 87, "20250101": 87, "202602": 86, "2026020735154": 86, "203": 81, "20341231": 87, "20350101": 87, "204": [41, 81], "204188": [41, 46, 84, 87], "204189": [38, 80], "20419": 80, "20440": 11, "20441231": 87, "20450101": 87, "205": [17, 61, 81], "20541231": 87, "20550101": 87, "205coordin": 17, "206": [23, 37, 38, 41, 46, 61, 67, 68, 81, 83, 84, 87], "2060": 46, "206017": 67, "2060nbnd": 46, "20641231": 87, "20650101": 87, "206667": 81, "20694": 41, "207": 81, "20741231": 87, "20750101": 87, "208": [20, 23, 41, 81], "20841231": 87, "20850101": 87, "209": 81, "20941231": 87, "209424": [41, 46, 84, 87], "209427": [38, 80], "20943": 80, "20950101": 87, "2098": 20, "20c": [36, 38, 43], "20cft_citru": 80, "20gb": 87, "20south_north": 67, "20th": 38, "21": [8, 20, 23, 28, 38, 41, 46, 67, 72, 80, 83, 84, 86, 87], "210": [41, 72, 81], "2100": [8, 36, 37, 38, 46, 68, 72, 87], "21001231": 87, "21013": 80, "21013landunit": 80, "211": [41, 81], "212": [61, 81, 84], "21241603e": 73, "213": [41, 46, 72, 81, 83, 84], "213333": 81, "214": 81, "21424802e": 73, "21466": 46, "2146959360": 46, "2146959360long_nam": 46, "2147483647": 61, "215": [41, 77, 81], "21524404": 81, "216": [46, 80, 81, 84], "2160": 72, "21650899": 39, "216665": 81, "217": [41, 81], "2177280": 67, "21790701": 81, "218": [41, 81], "2184": 73, "2185": 73, "2186": 73, "2187": 73, "2188": 73, "2189": 73, "219": [41, 72, 81], "2190": 73, "2191": 73, "2192": 73, "2192arrai": 73, "2193": 73, "21930": 73, "2193dask": 73, "2193eta_rho": 73, "219895": 46, "21aaa4ef": 41, "21cft_irrigated_citru": 80, "21coordin": 67, "21isic": 67, "21iswat": 67, "21st": 82, "22": [8, 17, 38, 39, 41, 46, 61, 67, 72, 80, 81, 83, 84, 86, 87], "220": 81, "22052261": 39, "221": [41, 81], "22139278e": 73, "222": 81, "223": [41, 81, 83], "2232": 86, "224": 81, "22442060709": [72, 83, 84], "224421": [46, 72, 83, 84], "22464592306768": 86, "22487": 41, "225": [41, 61, 81], "22500": 61, "22507977485657": [72, 83, 84], "22508": [38, 41, 46, 72, 83, 84], "2250859320": 86, "225131": [41, 46, 84, 87], "225132": [38, 80], "225783e": [39, 61, 68], "225832": 81, "226": [41, 81], "22632": 41, "2267": 41, "227": 81, "22708": 41, "22745": 41, "22787": 41, "228": [41, 72, 81], "2284507": 81, "229": 81, "22cft_cocoa": 80, "23": [8, 23, 37, 38, 41, 46, 61, 63, 65, 67, 72, 73, 80, 81, 83, 84, 87], "230": [41, 81, 83], "230366": [41, 46, 84, 87], "2303664921466": [84, 87], "23037": [38, 80], "2304": 61, "23048": 86, "231": [81, 83], "23133097": 81, "232": [37, 38, 41, 46, 72, 81, 83, 84], "233": 81, "2332806": [72, 83], "234": [41, 81, 84], "23459477": 39, "234624": 41, "235": 81, "235054": 41, "235602": 46, "236": [41, 81], "237": [61, 81], "23753": 41, "238": [41, 81], "239": 81, "23950080": 67, "23cft_irrigated_cocoa": 80, "23gb": 87, "23rd": [8, 66, 82], "23x0": [72, 83], "24": [8, 17, 20, 38, 41, 46, 51, 60, 67, 68, 72, 73, 80, 81, 83, 84, 87], "240": [20, 39, 41, 46, 67, 72, 81, 83], "2400": 61, "2400nlon": 61, "2401": 61, "2401nlon_b": 61, "240499": 84, "2404990196228": 84, "24052915": 39, "240838": [38, 41, 46, 80, 84, 87], "241": [41, 81], "241902": [38, 41, 46, 72, 83, 84], "2419023513794": [72, 83, 84], "242": 81, "243": [41, 81, 83], "244": [51, 81, 83], "244567e": [39, 61, 68], "245": [41, 72, 81], "245482": 46, "246": 81, "246073": [41, 46, 84, 87], "246075": [38, 80], "24621668": 39, "24693": 67, "247": [41, 81], "247320": 86, "247498": 81, "248": [46, 65, 72, 81, 83], "24806791e": 73, "24845055": 81, "249": [23, 41, 81], "249998": 81, "24cft_coffe": 80, "24eta_rho": 73, "24th": [8, 49], "25": [7, 8, 16, 20, 37, 38, 41, 46, 51, 61, 65, 67, 68, 72, 80, 81, 83, 84, 86, 87], "250": [41, 61, 81, 87], "2500": 61, "25000": 61, "250000e": [39, 61, 68, 72, 83], "25000897": 39, "2500e": 86, "2501": 39, "250e": [72, 86], "251": [41, 46, 72, 81, 83, 84], "25103166": 81, "2512": 20, "251309": 46, "25133086": 39, "252": 81, "2522664000": 86, "253": [41, 65, 81], "254": [41, 81], "2541": 41, "255": [41, 46, 72, 81, 83, 84], "255239523947239": [72, 83, 84], "25524": [46, 72, 83, 84], "25577325": 39, "256": [8, 41, 43, 81, 84], "2560": 38, "2561": 38, "256545": 46, "25664": 67, "256gb": 43, "257": 81, "25723arrai": 61, "258": [41, 51, 81], "25875887e": 73, "259": [28, 81], "25_hist_78pfts_trendy_simyr1700_c190814": 80, "25_nc3000_nsw042_nrs008_co060_fi001_zr_sgh30_24km_grnl_c170103": [84, 87], "25_remap_c051027": 38, "25cft_irrigated_coffe": 80, "25deg": 83, "25e": 86, "25levlak": 80, "25lon": 80, "25th": [8, 34], "26": [8, 37, 38, 41, 46, 60, 67, 71, 72, 80, 81, 84, 86, 87], "260": [28, 41, 65, 81], "261": [28, 81], "26135": 65, "26178": [38, 41, 46, 80, 84, 87], "262": [28, 41, 61, 81], "263": [28, 81], "264": [28, 41, 81, 84], "2640": 72, "265": [41, 80, 81], "2654208": [72, 83], "2654208coordin": [72, 83], "265arrai": 80, "266": [41, 67, 81], "267": 81, "26701": 80, "267014": [38, 80], "267016": [41, 46, 84, 87], "267f8112b7b54af2dbd898356bfcb6f7": 73, "268": [41, 81], "26822889e": 73, "26829977333546": [72, 83], "2683": [38, 46, 72, 83], "268680e": [39, 61, 68], "269": 81, "2694": 61, "26cft_cotton": 80, "26th": [8, 58, 82], "27": [8, 16, 17, 32, 38, 41, 46, 61, 65, 67, 72, 80, 81, 84, 87], "270": [41, 81], "270000e": 80, "2705": 37, "271": [41, 81], "271692": 41, "272": [41, 81], "272251": 46, "2723049127": 20, "273": [37, 38, 41, 46, 72, 81, 83, 84], "273001": 84, "27300125360489": 84, "27313195537674": 86, "27368": 86, "274": [81, 84, 90], "275": [17, 41, 61, 65, 73, 81, 90], "27500": 61, "2753": 61, "275y": 17, "276": 81, "2765": 61, "276665": 81, "276667": 81, "276820": 46, "277": [41, 81], "277280e": [39, 61, 68], "277487": 46, "278": 81, "279": [41, 81, 83], "27997": 41, "27cft_irrigated_cotton": 80, "27th": [8, 19], "28": [8, 16, 28, 32, 37, 38, 39, 41, 46, 60, 61, 67, 68, 72, 80, 81, 83, 84, 86, 87], "280": [81, 86], "280005": 81, "281": [38, 41, 81, 86], "28146696": 81, "28179298": 81, "282": [81, 86], "28241782": 81, "282722": [38, 80], "282723": [41, 46, 84, 87], "283": [41, 51, 81, 86, 90], "284": [46, 81, 86], "284599": 41, "285": [41, 81, 86], "28551": 41, "286": [41, 81, 86], "287": [61, 81], "287956": [38, 80], "287958": [41, 46, 84, 87], "28795811518324": [84, 87], "28796": 80, "288": [38, 41, 46, 65, 80, 81, 84, 87], "2881": 65, "2882": 46, "288271": 41, "28854": 11, "28855": 11, "28856": 11, "288coordin": [46, 65], "288dask": [41, 46, 80, 87], "288ilev": [46, 84], "288lat": [80, 87], "288nbnd": 38, "288vegtyp": 80, "288zlon": 84, "289": [67, 81], "28901640e": 73, "28_03": 67, "28cft_datepalm": 80, "28t00": 46, "28t03": 67, "28t06": 67, "28t09": 67, "28t12": 67, "28t15": 67, "28t18": 67, "28t21": 67, "28th": [8, 21, 27], "29": [7, 8, 11, 30, 38, 41, 46, 61, 67, 68, 72, 80, 81, 83, 84, 86, 87], "290": [41, 51], "2903040": 67, "29031715": 39, "29031716": 39, "29065347072": 84, "291014": 46, "292": [41, 72], "2920": 83, "2920nbnd": 83, "2920ncol": 83, "29231": 41, "29247755224156": 86, "293": 46, "293194": 46, "294": 41, "29408252": 39, "29443": 46, "295": 81, "29595947265625": [72, 83], "296": [41, 46, 72, 83, 84], "2962": 20, "29642832": 39, "298": [41, 61, 83], "298429": [38, 41, 46, 80, 84, 87], "29989059": 81, "29cft_irrigated_datepalm": 80, "29t00": 67, "29t03": 67, "29t06": 67, "29t09": 67, "29t12": [46, 67], "29t15": 67, "29t18": [11, 67], "29t21": 67, "29th": 11, "2ab787b8": 37, "2afb02c0": 37, "2arrai": 41, "2cell_method": 46, "2cen_lat": 67, "2cft_temperate_corn": 80, "2coordin": [23, 38, 46, 61, 68, 73, 80, 83, 86], "2cosp_tau": 72, "2ctype_crop_noncompet": 80, "2d": [25, 63, 72, 73, 80, 83], "2d27": 46, "2descript": 67, "2df5": 67, "2e": [61, 72], "2gb": 62, "2i2c": [29, 63], "2lat": 83, "2lev": 84, "2lon": [61, 87], "2long_nam": 41, "2ltype_unus": 80, "2min": 46, "2mstorag": 80, "2n_a": [72, 83], "2nd": [8, 11, 16], "2r47banl": 41, "2slat": 46, "2valid_min": 41, "2var_desc": 81, "2z_i": 86, "2zlon": 84, "3": [7, 8, 11, 12, 13, 17, 18, 20, 28, 30, 32, 36, 38, 39, 41, 44, 46, 51, 61, 65, 67, 68, 72, 73, 77, 80, 81, 84, 86, 87], "30": [7, 8, 11, 20, 23, 32, 38, 41, 46, 61, 63, 65, 67, 68, 72, 73, 75, 77, 80, 81, 83, 84, 86, 87], "300": [41, 46, 61, 65, 67, 84, 86], "3000": 61, "30000": 61, "3000e": 86, "3006856": 86, "300z_l": 86, "301": 41, "30156": 41, "30160692": 39, "303": 41, "303665": [38, 41, 46, 80, 84, 87], "30467797e": 73, "30481": 41, "3049999": 46, "305": 41, "307": 41, "30846": 41, "308901": 46, "309": 41, "30bnd": 46, "30cft_foddergrass": 80, "30ilev": [72, 83], "30lat": 38, "30t00": [46, 67], "30t03": 67, "30t06": 67, "30t09": 67, "30t12": [46, 67], "30t15": 67, "30t18": [11, 67], "30t21": 67, "31": [7, 8, 11, 18, 36, 38, 41, 46, 67, 68, 72, 80, 81, 83, 84, 86, 87], "310": [65, 84], "31032": 86, "310974": 67, "311": 41, "3111": 68, "3111cell_method": [39, 61], "3111long_nam": [61, 68], "312": 61, "3120": 72, "3122": 41, "3125": [72, 83], "31250886": 39, "313": 41, "314136": 46, "315": 41, "3153792": 84, "316": [41, 65], "317": 39, "31712663173676": [72, 83, 84], "317127": [38, 41, 46, 72, 83, 84], "31757": 41, "318": [39, 41], "319": 39, "319372": [38, 41, 46, 80, 84, 87], "31_bilinear": [72, 83], "31arrai": 68, "31cft_irrigated_foddergrass": 80, "31cosp_pr": 72, "31lev": 46, "31long_nam": 46, "31mdocstr": 28, "31mfile": 28, "31minit": 28, "31msubclass": 28, "31mtype": 28, "31nbnd": 83, "31ncol": 83, "31t00": [46, 67], "31t03": 67, "31t06": 67, "31t09": 67, "31t12": [46, 67], "31t15": 67, "31t18": [11, 67], "31t21": 67, "31time": 83, "31time_coverage_dur": 61, "32": [7, 38, 41, 46, 61, 65, 67, 72, 80, 83, 84, 86, 87], "320": [28, 39, 41, 67, 68], "320coordin": 39, "320d2": 68, "320dask": 68, "321": 39, "322": [38, 39, 41, 46, 72, 83, 84], "32202": 41, "322e45e": 46, "323": 39, "323364": 67, "3234828710556": [72, 83], "323483": [46, 72, 83], "324": [39, 41, 87], "324607": [41, 46, 84, 87], "324608": [38, 80], "32461": 80, "324631": [46, 72, 83, 84], "3246314823627": [72, 83, 84], "325": [61, 80], "32500": 61, "325407": [38, 41, 46, 72, 83, 84], "325407391414": [72, 83, 84], "326": 41, "327558cf": 67, "32794": 37, "328": 41, "32852": 84, "32855": 37, "32910": 41, "32950": 86, "329843": 46, "32cft_grape": 80, "32ilev": 84, "32lat": [41, 84], "32mnone": 28, "32z": 61, "33": [7, 38, 41, 46, 65, 72, 80, 83, 84, 86, 87], "330": 41, "33049": 41, "330658": 41, "331": 41, "331665": 81, "33238192e": 73, "332777e": 80, "332806": 41, "332969": [46, 72, 83, 84], "3329690098763": [72, 83, 84], "333": 41, "333333": 86, "33333333333326": 86, "3333333333333333read": 80, "33333333333337": 86, "33354": 41, "335": 41, "335079": 46, "3352": 38, "33598": 41, "336": [20, 67], "3362": 65, "33624": 41, "33692": 68, "337": [41, 61], "33706454": 81, "33827": 41, "338688": 61, "338822": 46, "339": 41, "33cft_irrigated_grap": 80, "33nbnd": 84, "33time": 84, "34": [7, 28, 37, 38, 41, 46, 51, 71, 72, 80, 84, 86, 87], "340": 86, "340313": [38, 80], "340314": [41, 46, 84, 87], "340834": 81, "341": [23, 41], "342": 71, "342457": 46, "343": 41, "3437": 37, "344": [65, 86], "3441": 41, "34434": 41, "34462": 61, "3448": 20, "3449059562": 41, "345": 41, "3455497382199": [84, 87], "34555": [41, 46, 80, 84, 87], "345551": [38, 80], "346": [23, 41], "34664": 86, "34670": 41, "34684689": 81, "347": [84, 87], "348": [41, 46, 72, 83, 84, 87], "34834": 41, "349": 86, "34961": 67, "34cft_groundnut": 80, "34m": 28, "34nv": 86, "35": [20, 37, 38, 41, 46, 61, 65, 68, 72, 80, 81, 84, 86, 87], "350": [41, 51, 61, 84, 87], "3500": 61, "35000": 61, "350000e": [39, 61, 68], "3506875": 39, "35071255929034": 86, "350785": 46, "350e": 86, "351": [84, 87], "3510": 18, "35112": 41, "352": [41, 51, 84, 87], "35247403e": 73, "35266246": 81, "353": [84, 87], "35324": 37, "35342745": 39, "35352": 86, "3536666929722": [72, 83, 84], "353667": [46, 72, 83, 84], "3538944": [72, 83], "354": 41, "354164": 81, "35418436": 81, "355": [38, 41, 46, 80, 84, 87], "35514": 86, "356": [38, 41, 46, 72, 80, 83, 84, 87], "356021": [38, 41, 46, 80, 84, 87], "356632": [38, 41, 46, 72, 83, 84], "356632251292467": [72, 83, 84], "356668": 81, "357": [38, 41, 46, 72, 80, 83, 84, 87], "35723876953125": [72, 83], "35739": 41, "35795": 41, "358": [38, 41, 46, 72, 80, 83, 84, 87], "359": [41, 72, 81, 83], "35918431": 81, "35934": 37, "35941": 41, "35992386148148": 86, "35cft_irrigated_groundnut": 80, "35coordin": 86, "35e": 61, "35time": 46, "36": [7, 17, 28, 37, 38, 41, 46, 72, 80, 83, 84, 86, 87, 88], "360": [23, 41], "3600": [61, 72], "360000e": 80, "3600coordin": 61, "3600month": 61, "3600nlat_b": 61, "3601": 61, "3601coordin": 61, "3606": 80, "360lat": 41, "361256": [38, 80], "361257": [41, 46, 84, 87], "362": 61, "36298": 41, "363": 11, "3630706071854": [72, 83, 84], "363071": [46, 72, 83, 84], "36320": 41, "364": 11, "364088e": [39, 61, 68], "365": [8, 11, 28, 38, 39, 61, 68, 87], "3650": 84, "36501": 41, "36575": 86, "366": 11, "3664": 86, "366492": 46, "366588": [46, 72, 83, 84], "3665883541107": [72, 83, 84], "36674": 37, "36750": 37, "36759": 37, "36798033e": 73, "36870": 37, "36arrai": 46, "36cft_millet": 80, "36lon": 46, "36m0": 28, "36m1": 28, "36unit": 41, "36x": 17, "37": [7, 37, 38, 41, 46, 61, 65, 67, 68, 72, 80, 84, 87], "370": 20, "37012": 41, "371728": 46, "372": 61, "37239": 65, "37300": 41, "374": 41, "37428615e": 73, "3747cfcf": 68, "375": [41, 61, 67, 72, 83], "37500": 61, "375000e": [39, 61, 68], "375009": 39, "375392e": [39, 61, 68], "37543": 67, "37597": 84, "375e": [28, 39, 61, 68, 86], "37601": 37, "37603": 68, "37640": 41, "376963": [38, 41, 46, 80, 84, 87], "377": 80, "3778": 41, "3779": 41, "378": 67, "3780": 41, "3781": 41, "3782": 41, "37823": 46, "37861": 37, "378south": 67, "378west_east": 67, "379": [38, 41, 46, 67, 72, 83, 84], "379793e": [39, 61, 68], "379913": 41, "379bottom": 67, "379gridtyp": 67, "379parent_grid_ratio": 67, "379west_east_stag": 67, "37cft_irrigated_millet": 80, "38": [7, 17, 38, 39, 41, 46, 61, 67, 72, 80, 83, 84, 87], "380776": 41, "3810240": 67, "3810394638": 80, "382199": [41, 46, 84, 87], "3822": 80, "382202": [38, 80], "3828": 80, "3828coordin": 80, "3828hist_interv": 80, "3828pft": 80, "3828vegtyp": 80, "384": [28, 39, 68, 87], "38447": 41, "38461": 41, "384b9509": 46, "384nlon": [39, 68], "38517": 41, "38580": 38, "38592": 37, "38619": 41, "387": 61, "387435": 46, "38779": 67, "388626e": [39, 61, 68], "38943": [38, 41, 46, 72, 83, 84], "3894303143024": [72, 83, 84], "38cft_oilpalm": 80, "38south_north": 67, "38west": 67, "39": [7, 38, 41, 46, 65, 67, 72, 80, 84, 86, 87], "390": 83, "39016": 86, "39032": 46, "391": 41, "391205": 41, "39194": 41, "392": 83, "3923": 41, "39267": 46, "39383": 37, "39387129": 68, "39417": 41, "39483": 41, "395": 67, "39511": 41, "39517": 37, "39546": 86, "3957478e": 46, "39578": 41, "395e": 72, "39630478e": 73, "39636": 41, "3970": 20, "3971": 73, "39734": 41, "39748": 83, "39753": 41, "3978": 73, "397906": [41, 46, 84, 87], "397907": [38, 80], "39794947": 81, "397e": 61, "39800": 41, "39854": 37, "39893": 37, "398e": 61, "399168": 81, "3996136": 86, "399e": 61, "39cft_irrigated_oilpalm": 80, "3af9d394f1c6": 73, "3arrai": [65, 80], "3bnd": 87, "3c6e": 87, "3cecef19f78": 83, "3cecef1acbfa": 67, "3cecef1b11d": 61, "3cecef1b11e4": 68, "3cecef1b11f8": 87, "3cecef1b11fa": [38, 41, 84], "3cecef1b1236": 46, "3cecef1b12d4": 86, "3cft_irrigated_temperate_corn": 80, "3coordin": 87, "3ctype_landice_multiple_elevation_class": 80, "3d": [8, 32, 63, 73, 83, 86, 87, 91], "3d08bca5": 83, "3d_field": 47, "3descript": 67, "3fb4": 41, "3h": 83, "3hrly": 83, "3ltype_landice_multiple_elevation_class": 80, "3min": 84, "3mstorag": 80, "3nv_b": [72, 83], "3pm": 6, "3simulation_start_d": 67, "3time": 87, "3titl": 61, "3xarrai": 80, "3z": 67, "3z_t": 39, "4": [7, 8, 11, 13, 15, 17, 18, 20, 23, 25, 28, 30, 31, 36, 37, 38, 39, 41, 43, 46, 47, 51, 61, 65, 67, 68, 72, 73, 77, 80, 81, 84, 86, 87], "40": [7, 17, 20, 37, 38, 40, 41, 46, 61, 65, 72, 75, 77, 80, 81, 84, 87], "400": [20, 23, 39, 41, 61, 72, 83], "4000": [61, 63, 81], "40000": 61, "4000e": 86, "400497e": [39, 61, 68], "40121": 37, "40127062797546": 84, "4012706279755": [72, 83], "401271": [46, 72, 83, 84], "40194": 41, "402092": 67, "40213": 37, "40217": 38, "40259": 67, "403141": [41, 46, 84, 87], "40314136125654": [84, 87], "403145": [38, 80], "403287": 65, "40363": 41, "40381": 41, "404": 61, "40429": 41, "404481": [38, 41, 46, 72, 83, 84], "404481112957": [72, 83, 84], "40483624": 81, "40561": 41, "40586": 37, "40589": 41, "40662": 37, "407": 61, "40729": 37, "4080": 72, "408377": 46, "408m": 61, "409": [20, 46, 72, 83, 84], "40939": 37, "4094925": 67, "40979": 37, "40997": 67, "409a": 84, "40cft_potato": 80, "40cosp_sr": 72, "40lon": 81, "40time": 38, "41": [17, 38, 39, 41, 46, 51, 67, 72, 80, 83, 84, 87], "410": [20, 87], "411": 86, "41193498": 39, "412": 61, "41349": 41, "4135549": 39, "413613": [38, 41, 46, 80, 84, 87], "41381": 41, "41383": 37, "413972e": [39, 61, 68], "41397858": 39, "414762": 65, "415": 17, "41518": 41, "41635": 11, "41636": 11, "41637": 11, "41639": 41, "41646713": 81, "417498": 81, "417656": 80, "41805": 37, "41841155": 39, "41865507": 39, "418848": [41, 46, 84, 87], "41885": [38, 80], "4188851": 81, "419165": 81, "419168": 81, "41925": 41, "41cft_irrigated_potato": 80, "41long_nam": 39, "42": [38, 39, 41, 46, 51, 61, 72, 80, 84, 87], "420": 20, "42007": 41, "42090586": 81, "42132": 37, "421667": 81, "42231954773574": 86, "4225": 81, "42302146": 81, "42324": 37, "42370": 41, "424084": 46, "425": 61, "42500": 61, "426186": 41, "42649554": 39, "42672688e": 73, "42676562": 81, "42698694667925": 86, "427": 38, "42710": 37, "42757": 41, "427712938": 61, "428082": 41, "42880": 37, "429": 17, "42903": 80, "429319": 46, "42cft_puls": 80, "43": [38, 41, 46, 72, 80, 84, 87], "430": 36, "431": 36, "43115355": 81, "43117": 41, "431665": 81, "432": [36, 80], "4320": 86, "4323345348239": [72, 83, 84], "432335": [46, 72, 83, 84], "4326longitude_of_prime_meridian": 61, "433": 36, "43348": 41, "433777e": [39, 61, 68], "43385804": 81, "434": [28, 36, 39], "43415481": 81, "434555": [38, 41, 46, 80, 84, 87], "435": 36, "436666": 81, "437": 61, "4375": [72, 83], "43750889": 39, "4383": 67, "43851": 86, "439": 83, "43962": 84, "439789": [38, 80], "43979": 80, "439791": [41, 46, 84, 87], "43aadd5b": 61, "43cft_irrigated_puls": 80, "44": [38, 41, 46, 61, 72, 80, 81, 84, 87], "44002406e": 73, "4410": 46, "44174": 41, "442": 38, "44220": 41, "443": 61, "44356": 41, "44387": 41, "44458745": 81, "445": [38, 41, 46, 72, 81, 83, 84], "445026": 46, "44585338e": 73, "4458916187286": [72, 83, 84], "445892": [46, 72, 83, 84], "44592": 41, "446": 20, "44713": 41, "44954": 37, "44ba": 68, "44c2": 38, "44cft_rapese": 80, "44e3": 37, "45": [20, 38, 41, 46, 61, 65, 67, 72, 77, 80, 83, 84, 87], "450": 61, "4500": 61, "45000": 61, "450000e": [39, 61, 68], "450262": 46, "450e": [72, 86], "451": 17, "45101": 41, "45121": 86, "45124": 41, "45128": 41, "45160767": 39, "4523087": 67, "45250": 37, "4528": 20, "45282": 67, "45373": 41, "454165": 81, "455497": [41, 46, 84, 87], "455498": [38, 80], "45567": 41, "4560": 72, "45631811": 81, "4577638": 39, "45783": 87, "458": 86, "45826": 41, "458334": 81, "45848": 87, "45848824": 81, "458xh": 86, "458xq": 86, "459167": 81, "4596939": 67, "45cft_irrigated_rapese": 80, "45e": 61, "46": [38, 41, 46, 72, 80, 81, 83, 84, 86, 87], "460": 84, "4602": 67, "46073": 80, "460732": [38, 80], "46073298429319": [84, 87], "460733": [41, 46, 84, 87], "46147": 37, "46172": 41, "462": 61, "46231": 41, "465834": 81, "465969": 46, "46702": 41, "469": 86, "46cft_rice": 80, "46d6": 73, "47": [38, 41, 46, 61, 67, 72, 80, 83, 84, 87], "47083": 81, "471204": [38, 41, 46, 80, 84, 87], "47201141e": 73, "4720874": 81, "47289604": 73, "47291": 73, "4738819": 73, "475": 61, "47500": 61, "4751677": 37, "47517149e": 73, "47522": 41, "475e": 61, "476042": 41, "47644": [38, 41, 46, 80, 84, 87], "4770631": 81, "47743868e": 73, "477692e": 41, "47861806": 73, "47cft_irrigated_ric": 80, "48": [38, 41, 46, 72, 80, 81, 84, 87], "480": 67, "4803": 73, "48039159630041": 86, "4805504e": 65, "4805507e": 65, "4805510e": 65, "4805513e": 65, "4805516e": 65, "4805519e": 65, "4805522e": 65, "4805525e": 65, "4805528e": 65, "4805531e": 65, "4805534e": 65, "4805537e": 65, "4805540e": 65, "4805543e": 65, "4805546e": 65, "4805549e": 65, "4805552e": 65, "4805555e": 65, "4805558e": 65, "4805561e": 65, "4805564e": 65, "4805567e": 65, "4805570e": 65, "4805573e": 65, "4805576e": 65, "4805579e": 65, "4805582e": 65, "4805585e": 65, "4805588e": 65, "4805591e": 65, "4805594e": 65, "4805597e": 65, "4805600e": 65, "4805603e": 65, "4805606e": 65, "4805609e": 65, "4805612e": 65, "4805615e": 65, "4805618e": 65, "4805621e": 65, "4805624e": 65, "4805627e": 65, "4805630e": 65, "4805633e": 65, "4805636e": 65, "4805639e": 65, "4805642e": 65, "4805645e": 65, "4805648e": 65, "4805651e": 65, "4805654e": 65, "4805657e": 65, "4805660e": 65, "4805663e": 65, "4805666e": 65, "4805669e": 65, "4805672e": 65, "4805675e": 65, "4805678e": 65, "4805681e": 65, "4805684e": 65, "4805687e": 65, "4805690e": 65, "4805693e": 65, "4805696e": 65, "4805699e": 65, "4805702e": 65, "4805705e": 65, "4805708e": 65, "4805711e": 65, "4805714e": 65, "4805717e": 65, "4805720e": 65, "4805723e": 65, "4805726e": 65, "4805729e": 65, "4805732e": 65, "4805735e": 65, "4805738e": 65, "4805741e": 65, "4806128e": 65, "4806131e": 65, "4806134e": 65, "4806137e": 65, "4806140e": 65, "4806143e": 65, "4806146e": 65, "4806149e": 65, "4806152e": 65, "4806155e": 65, "4806158e": 65, "4806161e": 65, "4806164e": 65, "4806167e": 65, "4806170e": 65, "4806173e": 65, "4806176e": 65, "4806179e": 65, "4806182e": 65, "4806185e": 65, "4806188e": 65, "4806191e": 65, "4806194e": 65, "4806197e": 65, "4806200e": 65, "4806203e": 65, "4806206e": 65, "4806209e": 65, "4806212e": 65, "4806215e": 65, "4806218e": 65, "4806221e": 65, "4806224e": 65, "4806227e": 65, "4806230e": 65, "4806233e": 65, "4806236e": 65, "4806239e": 65, "4806242e": 65, "4806245e": 65, "4806248e": 65, "4806251e": 65, "4806254e": 65, "4806257e": 65, "4806260e": 65, "4806263e": 65, "4806266e": 65, "4806269e": 65, "4806272e": 65, "4806275e": 65, "4806278e": 65, "4806281e": 65, "4806284e": 65, "4806287e": 65, "4806290e": 65, "4806293e": 65, "4806296e": 65, "4806299e": 65, "4806302e": 65, "4806305e": 65, "4806308e": 65, "4806311e": 65, "4806314e": 65, "4806317e": 65, "4806320e": 65, "4806323e": 65, "4806326e": 65, "4806329e": 65, "4806332e": 65, "4806335e": 65, "4806338e": 65, "4806341e": 65, "4806344e": 65, "4806347e": 65, "4806350e": 65, "4806353e": 65, "4806356e": 65, "4806359e": 65, "4806362e": 65, "4806365e": 65, "480coordin": 67, "480num_st_lay": 67, "480west": 67, "481": 67, "481675": 46, "481982": 81, "481e": 65, "481j_parent_end": 67, "481south": 67, "481z": 67, "482": [46, 72, 73, 83, 84], "483": 73, "48359": 80, "48359column": 80, "48374655": 73, "48375397": 73, "484": [67, 73, 84], "48434403": 73, "48435021": 73, "484448256": 87, "485": 73, "485479535535": [72, 83, 84], "48548": [38, 41, 46, 72, 83, 84], "48567938": 73, "486": 73, "48637802": 39, "4864": 73, "48643687": 73, "48644143": 73, "48684994": 73, "48685308": 73, "486911": 46, "487": [61, 73], "48726019": 73, "48726435": 73, "48735222": 73, "48737022": 73, "48756839726296": 86, "48793556": 73, "488": 73, "48840649": 73, "488arrai": 73, "489": 73, "48936224": 73, "48945836": 73, "48946273": 73, "48960257": 73, "489xi_rho": 73, "48cft_sorghum": 80, "49": [23, 38, 41, 46, 61, 72, 80, 81, 84, 87], "49117019": 73, "49118142": 73, "492147": [38, 41, 46, 80, 84, 87], "49220683": 73, "49230075": 73, "4923025": 73, "49231": 41, "49269076e": 73, "49366889392412": 86, "49373412": 73, "494": 41, "49409571": 73, "49410785": 73, "494165": 81, "49446867": 73, "49448089": 73, "4945arrai": 73, "49462038": 73, "49462967": 73, "495": 41, "49520386": 73, "49520834": 73, "49536343": 73, "49536617": 73, "49545653": 81, "49589506": 73, "49594455": 73, "49594458": 73, "49611448": 73, "49612795": 73, "49636848": 73, "49642915": 73, "49738": 80, "497382": [41, 46, 84, 87], "497383": [38, 80], "4975": 81, "49770676": 73, "49770946": 73, "49777905": 73, "49778354": 73, "4978": 83, "49788316": 73, "4985": 68, "4985416": 86, "49895535": 81, "49901108": 73, "49901151": 73, "49903297": 73, "49912113": 73, "49917254": 73, "4991787": 73, "49929657": 73, "4993": 87, "49981401": 73, "49981748": 73, "49995467": 73, "49cft_irrigated_sorghum": 80, "49time": 46, "4arrai": [65, 80], "4baf": 61, "4cbf": 86, "4cf3": 41, "4cft_spring_wheat": 80, "4d": [73, 80], "4d1rk9dp": 41, "4d4e": 46, "4dask": 80, "4e": 61, "4flag_metgrid": 67, "4lat": 81, "4lev": 41, "4ltype_deep_lak": 80, "4n_": [72, 83], "4ne": [23, 72, 83], "4num_sm_lay": 67, "4pft": 80, "4rd": 13, "4refer": 17, "4south_north_stag": 67, "4th": [8, 16, 82], "4vegtyp": 80, "4version": 38, "4xarrai": 80, "4y": 80, "5": [0, 8, 11, 13, 17, 20, 23, 25, 28, 29, 30, 32, 36, 37, 38, 39, 41, 43, 46, 47, 61, 62, 65, 67, 68, 72, 73, 80, 81, 82, 83, 84, 85, 86, 87, 88, 90], "50": [20, 24, 37, 38, 41, 46, 61, 65, 67, 68, 72, 80, 83, 84, 87], "500": [7, 28, 37, 39, 41, 46, 61, 64, 68, 72, 81], "5000": [61, 86], "50000": [61, 83], "500000e": [39, 61, 68, 80], "500023cen_lon": 67, "500023stand_lon": 67, "50002593": 73, "5000e": 86, "50034415": 73, "5005749": 73, "500e": [72, 86], "50122301": 73, "50260723": 73, "50260979": 73, "502618": 46, "50274792": 73, "50275095": 73, "50307457": 73, "50307629": 73, "50321058": 73, "50350304": 73, "50361574": 73, "50364757": 73, "50365382": 73, "5040": 72, "5048": 73, "50493417": 73, "50501344": 73, "50509024": 73, "50509786": 73, "5051": 73, "5057565": 73, "50575825": 73, "5058": 73, "5065": [28, 39, 61, 68, 84, 87], "50703572": 81, "5073": 73, "507853": 46, "5082273": 73, "50832082": 73, "50832316": 73, "5089312": 73, "50893568": 73, "509154e": 41, "50960524": 73, "50965033": 73, "50966666": 73, "5097": 73, "50arrai": 72, "50c0": 83, "50cft_sugarbeet": 80, "50coordin": 87, "50cosp_ht": 72, "50cosp_sza": 72, "50gb": 46, "50k": 71, "50long_nam": 72, "51": [38, 41, 46, 61, 67, 68, 80, 81, 84, 87], "51028026": 73, "5102827": 73, "51029671": 73, "5103": 73, "51031117": 73, "51031365": 39, "51075928": 73, "51076364": 73, "510935e": [39, 61, 68], "51215224": 39, "5122": 20, "513088": [38, 80], "513089": [41, 46, 84, 87], "51309": 80, "51363979": 39, "513702e": [39, 61, 68], "51454096": 73, "51454733": 73, "51498191": 73, "51574038": 73, "51575231": 73, "51578852": 73, "516": 67, "51734334": 73, "51752643": 73, "51753427": 73, "51766482": 39, "51832460732984": [84, 87], "518325": [41, 46, 84, 87], "518326": [38, 80], "518335": 81, "51cft_irrigated_sugarbeet": 80, "52": [38, 41, 46, 61, 80, 84, 87], "520498": [41, 84], "52049824595451": 84, "52071202": 73, "5212416": 73, "5212arrai": 73, "5212xarrai": 73, "52166": 41, "523355": 41, "5235": 20, "52356": 46, "524": [38, 41, 46, 72, 83, 84], "525": 61, "525632": 84, "52682289": 73, "52684191": 39, "528": 83, "528796": 46, "52cft_sugarcan": 80, "53": [20, 38, 41, 46, 67, 72, 80, 81, 83, 84, 87], "5306396484375": [72, 83], "53064": [72, 83], "53403": 80, "534031": [38, 41, 46, 80, 84, 87], "534166": 81, "5347665250301": [72, 83, 84], "534767": [38, 41, 46, 72, 83, 84], "53510909": 81, "536615e": 41, "537500": [39, 68], "5375e": 86, "5386245362461": [72, 83, 84], "538625": [46, 72, 83, 84], "539": 72, "539167": 81, "539267": 46, "539795": 67, "53cft_irrigated_sugarcan": 80, "53long_nam": 46, "54": [38, 41, 46, 65, 72, 80, 81, 83, 84, 87], "540": 86, "540nv": 86, "540time": 86, "540yh": 86, "54131815": 81, "541946": 41, "542058": 84, "5427": 65, "544320": 67, "544503": 46, "545": [20, 39], "54608251505205": 86, "54721": 67, "54724076390266": [72, 83, 84], "547241": [38, 41, 46, 72, 83, 84], "54841014": 39, "549738": [38, 41, 46, 80, 84, 87], "54cft_sunflow": 80, "54unit": 41, "55": [20, 38, 41, 46, 61, 65, 67, 72, 73, 77, 80, 84, 87], "550": [20, 61], "5500": 61, "55000": 61, "550000e": [39, 61, 68], "5520": 72, "55385": 41, "554974": [41, 46, 84, 87], "554977": [38, 80], "55498": 80, "555": 61, "555317": [46, 72, 83, 84], "55531707406044": [72, 83, 84], "556095": [38, 41, 46, 72, 83, 84], "556095123291": [72, 83, 84], "55852034e": 73, "5599717795205": 86, "55cft_irrigated_sunflow": 80, "55e": 65, "56": [37, 38, 41, 46, 67, 68, 72, 80, 83, 84, 87], "560209": 46, "5625": [72, 83], "56250892": 39, "5625e": 86, "56390013e": 73, "565077e": 41, "565445": 46, "567": [46, 72, 83, 84], "5678": 15, "56789": 15, "568": 20, "56862": 81, "56cft_miscanthu": 80, "57": [38, 41, 46, 61, 67, 68, 72, 80, 81, 84, 87], "570": [20, 61], "570518": 41, "57068": 80, "570681": [38, 41, 46, 80, 84, 87], "571308": 41, "572502": 81, "573946e": [39, 61, 68], "575": 61, "5752": 20, "57591": 80, "575912": [38, 80], "575916": [41, 46, 84, 87], "5772": 51, "57748313": 83, "578": 84, "579": 20, "57cft_irrigated_miscanthu": 80, "57lat": 61, "57sourc": 80, "57time": 61, "58": [38, 41, 46, 61, 67, 73, 80, 84, 87], "580": 84, "580000e": 80, "581152": 46, "582": 83, "585833": 81, "58603923": 39, "5861487": 81, "586387": 46, "5868068933487": [72, 83, 84], "586807": [46, 72, 83, 84], "587499": 61, "58809725": 81, "58848746": 83, "58cft_switchgrass": 80, "58e": 65, "59": [20, 37, 38, 41, 46, 80, 81, 83, 84, 87], "59003": 67, "590625e": [72, 83], "59097600": 61, "59162": 80, "591621": [38, 80], "591623": [41, 46, 84, 87], "5919189453125": [72, 83], "59324513879179": 86, "593750e": [72, 83], "594819646328688": [72, 83, 84], "59482": [38, 41, 46, 72, 83, 84], "595": [38, 41, 46, 72, 83, 84], "59547974169254": [72, 83], "59548": [38, 46, 72, 83], "596859": 46, "596875e": [72, 83], "59741": 67, "5974696": 86, "59750403103993": 86, "597e": 61, "598e": 61, "59946073": 83, "599e": 61, "59cft_irrigated_switchgrass": 80, "5arrai": 72, "5cft_irrigated_spring_wheat": 80, "5coordin": [72, 80], "5ctype_wetland": 80, "5d3f": 37, "5de8302f": 46, "5dummi": 72, "5e": [28, 39, 61, 68, 86], "5gb": 73, "5long_nam": [41, 46, 72], "5ltype_wetland": 80, "5m": 15, "5min": 46, "5mt6p9na": 37, "5ncol": 72, "5standard_nam": 61, "5th": 85, "5time": 68, "5unit": 81, "5z_t": 68, "6": [0, 11, 12, 13, 14, 17, 20, 23, 28, 36, 37, 38, 39, 41, 44, 46, 47, 61, 65, 67, 68, 71, 72, 73, 80, 81, 83, 84, 86, 87, 88], "60": [20, 28, 36, 37, 38, 39, 41, 46, 61, 68, 72, 80, 84, 87], "600": [7, 8, 41, 61, 65, 68, 72, 84, 86, 87], "6000": [61, 72], "60000": 61, "600000e": 80, "6010": 20, "6011": 20, "6012": 20, "6013": 20, "6014": 20, "6015": 20, "602094": 46, "603077": 41, "6031": 68, "603321": 81, "605": 72, "607329": [38, 80], "60733": [41, 46, 84, 87], "609": [38, 41, 46, 72, 83, 84], "60cft_tropical_corn": 80, "60fd": 86, "60nlat": [39, 68], "60z_t": 68, "61": [36, 38, 41, 46, 68, 72, 80, 83, 84, 87], "61040262": 83, "61058124": 81, "611": 86, "61123": 73, "61129": 73, "61130": 73, "61131": 73, "61132": 73, "61187": 73, "61188": 73, "61189": 73, "61190": 73, "61191": 73, "61192": 73, "61193": 73, "61194": 73, "612": 86, "61218": 67, "61222": [38, 41, 46, 72, 83, 84], "612220004200935": [72, 83, 84], "612564": [38, 80], "612565": [41, 46, 84, 87], "61271724": 83, "61467574e": 73, "61500008": 83, "615e": 73, "616079": 41, "617104": 41, "6174": 46, "617801": 46, "618628": 41, "619": 86, "619997": 81, "61cft_irrigated_tropical_corn": 80, "61e": 65, "62": [28, 36, 38, 41, 46, 61, 80, 81, 83, 84, 87], "620": [20, 72], "620e": 72, "623": 83, "623037": 46, "624": 20, "62457": 67, "624991e": 61, "625": [41, 46, 61, 67, 72, 83], "62500": 61, "625190e": [39, 61, 68], "62589767000605": 86, "625e": [61, 86], "627670e": [39, 61, 68], "628272": [41, 46, 84, 87], "628273": [38, 80], "62cft_tropical_soybean": 80, "62nlat": 61, "63": [36, 38, 41, 46, 67, 72, 80, 81, 83, 84, 87], "63251636e": 73, "63332366": 81, "633507": [38, 80], "633508": [41, 46, 84, 87], "63351": 80, "637": 83, "6378137": 61, "638334": 81, "638743": 46, "63cft_irrigated_tropical_soybean": 80, "63ea4f6b110": 67, "64": [36, 38, 41, 46, 67, 73, 80, 83, 84, 86, 87], "640": [67, 72], "64150681863322": 86, "641507": 86, "641953": 46, "643": [38, 41, 46, 72, 83, 84], "64346569404006": [72, 83, 84], "643466": [38, 41, 46, 72, 83, 84], "643979": 46, "644546944648": [72, 83, 84], "644547": [38, 41, 46, 72, 83, 84], "648": 73, "6480": 72, "649": 73, "649001e": [39, 61, 68], "649093521": 84, "649215": [41, 46, 84, 87], "649216": [38, 80], "6493303": 39, "64time_period_freq": 80, "65": [36, 38, 41, 46, 61, 67, 73, 80, 84, 87], "650": [61, 73], "6500": 61, "65000": 61, "650984e": [39, 61, 68], "651": 73, "652": [46, 72, 73, 83, 84], "653": 73, "653168": 41, "65328": 17, "65379442": 81, "654": 73, "65445": 46, "654arrai": 73, "654xarrai": 73, "655": 73, "6550": 73, "655dask": 73, "655degre": 73, "65671145": 81, "658333": 81, "659686": 46, "659dbd": 18, "66": [38, 41, 46, 67, 80, 81, 84, 86, 87], "660": 46, "660833": 81, "663": 46, "66333": 81, "66407136": 81, "66443": 81, "6645321": 81, "664921": [41, 46, 84, 87], "664922": [38, 80], "66494518": 81, "665817": 41, "666573": 41, "666666": 81, "66666666666652": 86, "66666666666663": 86, "66666666666674": 86, "666667": 86, "66912293434143": [72, 83], "669123": [46, 72, 83], "66924": 41, "67": [20, 38, 41, 46, 61, 80, 81, 83, 84, 86, 87], "670157": [41, 46, 84, 87], "670158": [38, 80], "67016": 80, "67409912": 81, "675": 61, "675393": 46, "67542865": 81, "67624": 41, "676542e": [39, 61, 68], "67664": 67, "67749896645546": 84, "677499": [41, 84], "67780994884367": 86, "67781": 86, "679": 83, "679167": 81, "67c8ba06d7e1": 73, "67cartesian_axi": 86, "67ed": 87, "68": [38, 41, 46, 67, 80, 84, 86, 87], "680": 77, "680628": 46, "68204": 41, "6825": 81, "683412": 46, "683734": 41, "68396": 41, "684": 41, "68402": 41, "68405": 41, "68408": 41, "685863": [38, 80], "685864": [41, 46, 84, 87], "68630626": 39, "68677": 41, "6871747076511": [72, 83, 84], "687175": [38, 41, 46, 72, 83, 84], "6875": [72, 83], "68750895": 39, "6879": 41, "6890298": 81, "68903": 67, "6894720": 67, "689493": 41, "69": [38, 41, 46, 67, 80, 84, 86, 87], "6909084": 67, "691": [38, 41, 46, 72, 83, 84], "691099": [41, 46, 84, 87], "6911": 80, "691101": [38, 80], "6912960": 67, "69144862217053": 86, "6915": 41, "693": 83, "69321089982986": 84, "69321089982991": [72, 83], "693211": [46, 72, 83, 84], "69333": 81, "6951": 41, "695126": 41, "69570066e": 73, "6960": 72, "69626": 41, "696335": 46, "6963976": 86, "69962": 41, "69cell": 71, "6ae07e09": 87, "6ae5eeca": 87, "6arrai": [65, 72, 83], "6cft_winter_wheat": 80, "6ctype_urban_roof": 80, "6e": 86, "6formula_term": [38, 46, 84], "6h": 72, "6long_nam": [41, 72, 83, 84], "6ltype_urban_tbd": 80, "6mstorag": 83, "7": [8, 12, 13, 20, 22, 23, 28, 32, 36, 37, 38, 39, 41, 46, 51, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "70": [38, 41, 46, 61, 72, 80, 81, 84, 86, 87], "700": [37, 41, 61], "7000": 61, "70000": 61, "700000e": 80, "70063687": 81, "701": 41, "701418": [46, 72, 83, 84], "70141822099686": [72, 83, 84], "701483": 41, "7015": 41, "701571": 46, "7027306898779": 86, "7028ad57": 87, "70358949": 39, "704417": [46, 72, 83, 84], "70441716909409": [72, 83, 84], "705002": 81, "70557": 41, "70562482": 81, "70619098780386": 86, "706191": 86, "706806": [38, 41, 46, 80, 84, 87], "707499": 81, "708": 67, "71": [23, 38, 39, 41, 46, 65, 80, 84, 86, 87], "71143": 41, "712042": 46, "712509": 41, "71354076": 83, "713896": 65, "7139": 41, "71394044": 83, "71435405": 83, "71538": 41, "715866": [46, 72, 83, 84], "7158663570881": [72, 83, 84], "7162695": 83, "71717014": 81, "717277": 46, "719": 18, "71901211": 83, "71_v5oc_": 37, "71ctype_urban_sunwal": 80, "72": [38, 39, 41, 46, 61, 67, 72, 80, 81, 83, 84, 86, 87], "720": [18, 39, 61, 72], "72083": 81, "720lon": 61, "720nbound": 61, "721": 18, "72114": 37, "72176851": 83, "722": 18, "722513": [38, 41, 46, 80, 84, 87], "72287": 41, "723": 18, "72315176": 81, "72432654e": 73, "724998": 81, "725": [61, 81], "725760": 67, "72601591": 81, "7264988501736": 86, "726499": 86, "727749": [38, 41, 46, 80, 84, 87], "72775": 80, "72arrai": 46, "72ctype_urban_shadewal": 80, "72time": 46, "73": [38, 41, 46, 67, 80, 84, 86, 87], "730": [46, 72, 83, 84], "7308145": 81, "731667": 81, "7325": 81, "73276": 41, "7328": 41, "732984": 46, "73390508": 81, "734": 67, "73416": 41, "7343245": 46, "73467559512106": 84, "734676": 84, "73524335": 39, "7369": 41, "73822": 46, "73866267451815": 86, "738663": 86, "73881845": 39, "73881900e": 73, "73902120e": 73, "73ctype_urban_impervious_road": 80, "74": [23, 38, 41, 46, 80, 83, 84, 86, 87], "740": 72, "7411": 41, "742498": 81, "74269966208173": 86, "7427": 86, "743455": [41, 46, 84, 87], "743456": [38, 80], "7440": 72, "74423028": 81, "74424456": 39, "7452": 41, "74584418": 81, "74596231": 39, "74598346e": 73, "747": 41, "748": 83, "748688": [38, 80], "74869": 80, "748691": [41, 46, 84, 87], "74869143": 39, "74924": 41, "74cartesian_axi": 86, "74ctype_urban_pervious_road": 80, "75": [11, 38, 41, 46, 61, 67, 68, 72, 80, 83, 84, 87], "750": [61, 84], "7500": 61, "75000": 61, "75000884": 39, "7500e": 86, "75095784664154": 84, "750958": [41, 84], "750e": [72, 86], "7531": 41, "753227": 41, "75380113": 39, "753927": 46, "754790e": [39, 61, 68], "75581496e": 73, "755861": 65, "756": [20, 80], "75638": 41, "75662668307481": 86, "756e": 73, "757": [41, 80], "758": 80, "75817909": 81, "75820598": 81, "759": 80, "759162": 46, "75cft_c3_crop": 80, "75e": 86, "75read": 80, "76": [38, 41, 46, 65, 80, 81, 84, 86, 87], "760": 80, "760834": 81, "761108": 41, "761838": 41, "763": [38, 41, 46, 72, 83, 84], "764003e": [39, 61, 68], "764397": [38, 80], "764398": [41, 46, 84, 87], "76531982421875": [72, 83], "76532": [72, 83], "76542721": 39, "76566": 41, "766668": 81, "768": [46, 72, 83], "768244": 83, "768lon": [72, 83], "769634": 46, "77": [38, 39, 41, 46, 61, 67, 72, 80, 83, 84, 86, 87], "77116294": 81, "774869": 46, "77487": 41, "775": [61, 80, 81], "77614912": 81, "777498": 46, "777602": [23, 51, 72, 83], "777602dask": [72, 83], "777602n_b": [72, 83], "777602nbnd": 23, "777602time": [72, 83], "7786948084831": [72, 83, 84], "778695": [38, 41, 46, 72, 83, 84], "779167": 81, "78": [38, 39, 41, 46, 67, 80, 84, 86, 87], "780105": [38, 41, 46, 80, 84, 87], "782276e": [39, 61, 68], "78351267": 39, "7838": 41, "78462": 41, "785339": [38, 80], "78534": [41, 46, 80, 84, 87], "7862b3d1": 68, "788252e": [39, 61, 68], "789": 83, "78long_nam": 80, "79": [28, 38, 39, 41, 46, 80, 84, 86, 87], "790576": 46, "790833": 81, "7908477e": 46, "79141228": 81, "7920": 72, "79231": 41, "792501": 81, "7927": 41, "79362592": 81, "793729e": [39, 61, 68], "795000e": 80, "7953256": 86, "795812": 46, "796": [46, 72, 83, 84], "79984": 41, "7999996": 81, "79lat": 80, "79time": 80, "7arrai": [41, 72, 83], "7cft_irrigated_winter_wheat": 80, "7cosp_ht": 72, "7cosp_scol": 72, "7cosp_tau": 72, "7ltype_urban_hd": 80, "7nbnd": 72, "7r12h0e2": 73, "7th": [13, 82], "7z53ezhl": 37, "8": [8, 13, 17, 20, 23, 24, 28, 37, 38, 39, 40, 41, 44, 46, 47, 51, 61, 65, 66, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "80": [18, 37, 38, 41, 46, 47, 61, 67, 72, 80, 83, 84, 87], "800": [20, 23, 41, 61, 63, 72, 80, 83], "8000": 61, "80000": 61, "800000e": 80, "800497": 84, "80049747228622": 84, "80066936e": 73, "801046": [38, 80], "801047": [41, 46, 84, 87], "802": 20, "802017": 67, "80290802": 81, "80305": [8, 85], "804": 65, "804b": 68, "805834": 81, "806": 65, "80628": 80, "806282": [38, 80], "806283": [41, 46, 84, 87], "807461": 65, "807896": 41, "8080973": 81, "80859345409614": 86, "80917": 41, "809306": 46, "80931": 46, "80972794": 81, "80num_metgrid_level": 67, "80plev": 67, "81": [38, 41, 46, 67, 80, 81, 83, 84, 87], "811518": 46, "8125": [72, 81, 83], "81250898": 39, "813268": 81, "81357": 81, "813915": 41, "81464622": 81, "816754": 46, "8170": 83, "8175": 81, "81arrai": 65, "81c8": 87, "81institut": 61, "82": [20, 38, 41, 46, 61, 67, 80, 83, 84, 86, 87], "820": [38, 41, 46, 72, 83, 84], "82123": [38, 41, 46, 72, 83, 84], "82123029232025": [72, 83, 84], "82124959": 81, "82143389007075": 86, "82199": [41, 46, 80, 84, 87], "821991": [38, 80], "8225": 81, "824a2fbf35c5": 41, "825": 61, "82659912109375": [72, 83], "827225": 46, "827367e": [39, 61, 68], "82760085": 39, "82794339": 39, "828333": 81, "82861895859241": [72, 83, 84], "828619": [38, 41, 46, 72, 83, 84], "82901055": 81, "829168": 81, "83": [38, 41, 46, 67, 80, 84, 87], "83101581": 81, "831667": 81, "832461": 46, "835219": [46, 72, 83, 84], "83521938323975": 84, "8352193832398": [72, 83], "83626334": 81, "836664": 81, "836668": 81, "837696": [38, 41, 46, 80, 84, 87], "83785642": 81, "83b6": 41, "84": [20, 38, 39, 41, 46, 65, 67, 80, 84, 87], "8400": 72, "84166116": 81, "84220832e": 73, "842932": [41, 46, 84, 87], "842934": [38, 80], "844004": 65, "844164": 81, "8445": 41, "844985": 41, "845": [46, 72, 83, 84], "8454": 84, "847059e": [39, 61, 68], "848168": 46, "848e": 72, "8493": 73, "8495195": 46, "84daf380": 67, "85": [23, 38, 41, 46, 61, 80, 84, 87], "850": [37, 41, 61], "8500": 61, "85000": 61, "850769": 41, "85247188": 81, "853333": 81, "853403": 46, "854837e": [39, 61, 68], "85500": 65, "8564": 41, "857103": 41, "85800": 65, "858014768480534e": 83, "8583686500788": [72, 83, 84], "858369": [38, 41, 46, 72, 83, 84], "858639": [38, 41, 46, 80, 84, 87], "858f": 86, "859": [38, 41, 46, 72, 83, 84], "85914054": 81, "85e875639611": 46, "86": [38, 41, 46, 80, 84, 86, 87], "86100": 65, "86198425": 83, "862913e": [39, 61, 68], "8633526563644": [72, 83], "86335265636444": 84, "863353": [46, 72, 83, 84], "863874": [41, 46, 84, 87], "863876": [38, 80], "86388": 80, "865248": 46, "86747661232948": [72, 83], "867477": [46, 72, 83], "868334": 81, "86849939e": 73, "86911": 46, "86923": 41, "87": [38, 41, 46, 61, 72, 80, 83, 84, 86, 87], "870": 80, "870025e": [39, 61, 68], "873": [46, 72, 83, 84], "87348859": 81, "874346": 46, "874991e": 61, "875": [41, 46, 61, 72, 83], "87500887": 39, "875083e": [39, 61, 68], "875e": [61, 86], "8761": 87, "8761bnd": 87, "8761ensembl": 87, "8761lat": 87, "876452e": [39, 61, 68], "876663": 81, "87719d972cea": 37, "8772": 73, "877499": 81, "877502": 81, "8777279": 81, "878": 83, "8787": [17, 37, 38, 61, 62, 67, 68, 73, 83, 84, 86, 87], "87935564e": 73, "87958": 80, "879581": [38, 41, 46, 80, 84, 87], "88": [38, 41, 46, 61, 67, 72, 80, 83, 84, 87], "880646": 65, "88441506": 39, "884736": [72, 83], "884736nv_a": [72, 83], "884736x777602": 83, "884817": 46, "885": 65, "885872": 86, "88587227082127": 86, "885arrai": 65, "886667": 81, "8869": 68, "88697765": 81, "887": [38, 41, 46, 72, 83, 84], "887072e": 80, "88787841796875": [72, 83], "8880": 72, "88835": 41, "88914068": 81, "889385e": [39, 61, 68], "88standard_nam": 61, "89": [38, 41, 46, 61, 72, 73, 80, 81, 83, 84, 86, 87], "890": 83, "890052": 46, "89091": 61, "8926": 73, "8942536": 86, "89458361e": 73, "895288": [38, 41, 46, 80, 84, 87], "89592331": 81, "896e": 72, "8975": 81, "899164": 81, "89ef705a": 86, "8c1af8bb535a": 83, "8cft_temperate_soybean": 80, "8e18": 83, "8e28f4e6653ecaa445c49b8638c8f808": 80, "8e4cb217": 73, "8fa4": 38, "8long_nam": [38, 39, 41, 46, 80, 84], "8ltype_urban_md": 80, "8mstorag": 80, "8standard_nam": 87, "8th": [8, 33, 34], "8xarrai": 80, "9": [13, 17, 18, 20, 23, 28, 32, 37, 38, 39, 41, 46, 51, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87, 88, 90], "90": [37, 38, 41, 46, 61, 67, 72, 80, 83, 84, 87], "900": [46, 61, 72, 83, 84], "9000": 61, "90000": 61, "900000e": 41, "900524": [38, 41, 46, 80, 84, 87], "901667": 81, "90200509": 81, "90238945": 81, "90286181": 39, "903259": 41, "90444": 41, "905759": 46, "905832": 81, "90800497": 81, "9080867022276": [72, 83, 84], "908087": [38, 41, 46, 72, 83, 84], "90m": 61, "90th": 63, "91": [38, 41, 80], "9101": 86, "9101yh": 86, "91055696415611": 86, "9108167588711": [72, 83, 84], "910817": [38, 41, 46, 72, 83, 84], "910995": 46, "91170191e": 73, "912": [38, 41, 46, 72, 83, 84], "914999": 81, "9151": 68, "91615": 46, "91615lat": 46, "91623": [41, 46, 84, 87], "916231": [38, 80], "91786": 41, "91838308": 39, "92": [46, 51, 61, 67, 81, 84], "9201": 73, "92146": 80, "921463": [38, 80], "921466": [41, 46, 84, 87], "92203252": 81, "92325": [41, 84], "92325001955032": 84, "924": [46, 72, 83, 84], "925": [41, 61, 81], "926702": 46, "92753362": 81, "93": [41, 67, 72, 83], "93077": 41, "931937": 46, "9327": 61, "936": [38, 41, 46, 72, 83, 84], "9360": 72, "937172": [38, 80], "937173": [41, 46, 84, 87], "9375": [72, 83], "938007128": 87, "94": [41, 46, 67, 68, 72, 83, 84, 86], "940000e": 80, "94095708e": 73, "941042": [46, 72, 83, 84], "94104236364365": [72, 83, 84], "942408": 46, "94264": 41, "94356": 41, "944": 83, "9446": 41, "94557": 41, "94571": 41, "94579": 41, "945831": 81, "94620384e": 73, "9465928": 81, "94685": 41, "947": [46, 72, 83, 84], "947357": 41, "947644": 46, "94797035": 83, "94814": 41, "94817018": 83, "948313e": 80, "94837698": 83, "94933473": 83, "94942394516579": 86, "94994384332117": 86, "949944": 86, "94lon": 41, "95": [39, 41, 61, 67, 83, 86], "950": 61, "9500": 61, "95000": 61, "950000e": 80, "9503": 41, "95070604": 83, "951687": 41, "95208424": 83, "952368": 41, "95282074809072": [72, 83], "95282074809074": 84, "952821": [46, 72, 83, 84], "95288": [38, 41, 46, 80, 84, 87], "95289509": 39, "95366172e": 73, "95549": 41, "957": [38, 41, 46, 72, 83, 84], "95809872": 39, "958115": [38, 41, 46, 80, 84, 87], "95895063e": 73, "95983548": 39, "959997": 81, "96": [83, 87], "9603567": 81, "96115": 41, "96127947e": 73, "963351": 46, "96368482e": 73, "96429148e": 73, "964462": [46, 72, 83, 84], "9644624069333": [72, 83, 84], "96504258": 39, "967": [46, 72, 83, 84], "96724": 41, "968586": 46, "968944e": [39, 61, 68], "9692100e": 46, "97": [41, 46, 61, 67, 83], "970": 68, "97177": 41, "97240884": 39, "97371054": 39, "973822": [38, 41, 46, 80, 84, 87], "97383": 41, "975": 61, "976": [38, 41, 46, 72, 83, 84], "97653799": 81, "976603e": [39, 61, 68], "976e": 67, "97706761e": 73, "97883158e": 73, "979057": [38, 80], "979058": [41, 46, 84, 87], "97906": 80, "979166": 81, "97958746": 81, "98": [46, 65], "980001": 81, "9801": 61, "981667": 81, "984": 67, "9840": 72, "984293": 46, "985": [46, 72, 83, 84], "989166": 81, "989280": 86, "989529": 46, "98arrai": [65, 81], "99": [17, 41, 61], "990000e": 80, "99121132e": 73, "99178698e": 73, "992": [38, 41, 46, 72, 83, 84], "992574": [38, 41, 46, 72, 83, 84], "992574095726": [72, 83, 84], "99296571e": 73, "9931816": 86, "99379444": 81, "99403876066208": [72, 83, 84], "994039": [38, 41, 46, 72, 83, 84], "9947": 68, "994764": [41, 46, 84, 87], "994766": [38, 80], "9948368e": 46, "995e": 46, "99756192": 81, "99817482e": 73, "998611": 41, "99954669e": 73, "999708": 41, "9a2e31b9": 83, "9arrai": [65, 83], "9b41": 46, "9bca": 38, "9cft_irrigated_temperate_soybean": 80, "9coordin": 80, "9ctype_vegetated_or_bare_soil": 80, "9mb": 61, "9standard_nam": 61, "9th": [8, 66, 70, 78, 82], "9unit": 83, "9x": [84, 87], "9x1": [38, 80, 84, 87], "9xarrai": 65, "A": [4, 6, 7, 8, 12, 13, 14, 17, 18, 20, 28, 29, 31, 36, 38, 39, 40, 41, 44, 45, 46, 48, 50, 53, 57, 61, 62, 63, 64, 68, 69, 71, 72, 74, 79, 80, 81, 83, 84, 86, 88, 90, 92], "AS": [46, 68], "And": [1, 8, 10, 12, 15, 55, 72, 73, 74, 76, 80, 83, 88, 91], "As": [8, 10, 17, 20, 28, 32, 37, 39, 45, 57, 61, 67, 68, 72, 84], "At": [1, 8, 11, 17, 24, 25, 37, 42, 43, 44, 46, 50, 57, 72, 90], "Be": [0, 24, 30, 50], "But": [11, 14, 15, 38, 42, 73, 74, 81, 84], "By": [8, 10, 14, 15, 28, 40, 50, 65, 67, 68, 86], "For": [7, 8, 11, 12, 13, 17, 23, 28, 29, 31, 37, 38, 39, 42, 44, 46, 50, 51, 57, 61, 64, 65, 68, 71, 72, 74, 75, 80, 83, 84, 86, 87], "If": [1, 4, 6, 7, 8, 11, 12, 13, 14, 15, 16, 19, 20, 21, 25, 26, 27, 28, 29, 31, 32, 33, 34, 35, 37, 39, 41, 42, 44, 45, 49, 50, 52, 53, 54, 55, 56, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 73, 74, 75, 78, 79, 80, 81, 82, 83, 84, 86, 87, 88, 90], "In": [7, 8, 10, 11, 12, 13, 14, 15, 18, 20, 21, 23, 25, 28, 29, 32, 37, 38, 39, 41, 42, 43, 44, 45, 46, 47, 50, 51, 52, 57, 58, 61, 63, 65, 66, 67, 68, 71, 72, 73, 81, 83, 84, 85, 86, 87, 88, 90, 91, 92], "It": [4, 7, 8, 12, 14, 15, 19, 24, 25, 28, 33, 43, 45, 47, 50, 51, 53, 57, 61, 62, 67, 72, 73, 74, 81, 86, 87, 89, 90], "NO": 45, "No": [14, 20, 45, 69, 87], "Not": [10, 12, 15, 44, 81], "ONE": 69, "Of": 74, "On": [12, 28, 45, 59, 91], "One": [7, 8, 11, 12, 14, 15, 20, 28, 29, 32, 37, 39, 57, 61, 62, 64, 65, 80, 88], "Or": [1, 50, 74, 79], "Such": 86, "That": [14, 15, 65, 73, 87, 90], "The": [0, 1, 2, 3, 6, 7, 8, 12, 13, 14, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 60, 62, 63, 66, 67, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92], "Their": 63, "Then": [8, 11, 15, 49, 68, 74, 86, 88], "There": [7, 8, 13, 15, 17, 22, 23, 24, 29, 30, 31, 35, 37, 39, 42, 46, 47, 48, 51, 55, 61, 62, 65, 69, 71, 80, 84, 85, 86, 87, 89, 90], "These": [7, 8, 26, 27, 28, 35, 36, 42, 44, 55, 57, 59, 61, 62, 63, 66, 67, 72, 80, 81, 86, 88], "To": [0, 1, 7, 8, 10, 12, 15, 17, 40, 42, 67, 71, 72, 73, 75, 80, 84, 86, 88], "Will": [14, 29, 69], "With": [7, 8, 15, 20, 23, 46, 81, 90], "_": [13, 17, 41, 44, 46, 61, 86], "_04": 61, "__init__": [8, 69], "__saonvw": 41, "__version__": [17, 73], "_appli": 83, "_array_dimens": 86, "_build": [1, 44, 50], "_chunksiz": [46, 87], "_climo": 41, "_compute_corn": 61, "_conda_root": 12, "_config": 44, "_coo": 80, "_deflatelevel": 87, "_endian": 87, "_pars": 20, "_shuffl": 87, "_storag": 87, "_streams_dict": 28, "_toc": 44, "_v6quk4w": 86, "a00dc4ddb19f": 38, "a1ea": 84, "a3": 46, "a386": 67, "a45a": 73, "a49fcaa9": 61, "a73eb1b3": 38, "a84b": 46, "a916e23c": 41, "a974": 87, "aa26": 38, "ab": 61, "ab59": 73, "abanihi": 71, "abf7": 37, "abil": [2, 8, 28, 29, 44, 57, 80, 88], "abl": [6, 8, 10, 11, 12, 14, 20, 23, 24, 25, 39, 44, 52, 63, 65, 67, 87, 88, 90], "abouali": 10, "about": [4, 6, 8, 10, 11, 12, 13, 14, 15, 16, 22, 23, 25, 29, 30, 32, 37, 39, 41, 45, 50, 56, 57, 61, 62, 63, 65, 68, 73, 75, 80, 81, 84, 86, 87, 88], "abov": [8, 12, 14, 32, 35, 38, 44, 47, 50, 71, 89], "absenc": 13, "absent": [39, 61, 68], "absolut": [29, 39], "absolute_filepath": 18, "abstract": [10, 29, 31], "academ": [8, 63, 64, 92], "academia": 63, "acb9": 67, "accept": [7, 53, 67, 87, 90], "access": [8, 12, 14, 23, 25, 28, 30, 37, 39, 43, 44, 57, 59, 61, 62, 65, 74, 80, 86, 88, 90, 91], "accessor": 25, "accompani": [8, 71], "accomplish": [17, 24, 44, 59, 61, 68, 74], "accord": [11, 45, 87], "account": [7, 12, 15, 35, 57, 68, 88], "accumul": [63, 67, 73], "accur": [23, 84], "acdd": 61, "achiev": [8, 10, 23, 88], "acknowledg": [8, 61, 64], "across": [2, 8, 11, 20, 24, 25, 31, 36, 38, 46, 47, 63, 67, 80, 87, 88], "act": 12, "action": [2, 15, 62, 74], "activ": [1, 2, 7, 8, 12, 19, 21, 26, 27, 28, 30, 31, 32, 33, 34, 40, 45, 49, 54, 55, 56, 58, 63, 66, 70, 71, 74, 76, 78, 90], "actual": [8, 12, 13, 15, 29, 37, 46, 59, 62, 72, 73, 83, 84, 86, 87], "actual_rang": [41, 81], "acuiti": 88, "ad": [1, 7, 8, 13, 28, 29, 30, 31, 38, 43, 44, 52, 62, 63, 65, 68, 71, 72, 74, 79, 86, 88, 90], "ad98": 86, "adam": 62, "adapt": [8, 17, 86, 87], "adaptor": 51, "adcbb9db": 73, "add": [0, 6, 7, 8, 11, 13, 15, 19, 23, 25, 26, 27, 28, 29, 35, 36, 37, 39, 41, 44, 47, 48, 51, 52, 62, 63, 64, 65, 67, 68, 69, 71, 81, 84, 86, 87, 88, 90], "add_colorbar": 81, "add_cyclic_point": 43, "add_ensemble_dim": 87, "add_featur": 81, "add_lat_lon_ticklabel": 81, "add_major_minor_tick": 81, "addint": 63, "addit": [0, 6, 8, 11, 20, 23, 29, 32, 37, 38, 39, 41, 43, 44, 57, 59, 61, 63, 71, 83, 86, 88, 90], "address": [2, 6, 8, 12, 15, 21, 29, 58, 63, 66, 71], "addresse": 15, "adf": 24, "adhoc": 24, "adit": 75, "adjust": [31, 63, 68], "adminsitr": 88, "adminstr": 88, "adopt": 2, "adriaansen": [2, 91], "advanc": [2, 7, 8, 10, 16, 60, 67, 91], "advantag": [12, 67], "adventag": [8, 23], "advic": [6, 43], "advis": [15, 69], "advisor": 63, "ae4f": 84, "aeri": 63, "aerosol": 24, "afernoon": 63, "affect": [45, 73], "affili": 7, "aforement": 35, "after": [7, 8, 12, 13, 14, 15, 16, 23, 28, 43, 44, 46, 50, 57, 63, 66, 71, 72, 83, 84, 87, 90], "afternoon": [63, 88], "afterpuls": 63, "again": [13, 36, 50, 57, 67, 68, 74, 80, 84, 90], "against": [8, 41], "agenc": 63, "agenda": [8, 32, 85, 91], "aggreg": [8, 20, 23, 28, 38, 41, 42, 46, 62, 73, 84], "aggregationerror": 42, "agil": [8, 10], "agnost": 63, "ago": [8, 10, 50, 61, 63], "agre": [2, 15], "agrid_typ": 86, "aha": 73, "ahead": [25, 35, 39, 50, 77, 85], "ahijevych": 91, "aic": [20, 28], "aid": 92, "aim": [2, 7, 8, 30, 32, 71, 83, 84], "air": [17, 41, 46, 71], "air_temperatur": 71, "air_temperature_anomalyactual_rang": 46, "airs_01_climo": 41, "aka": [23, 67], "al": [8, 17, 31, 37, 72], "albani": 59, "albedo": [41, 67], "albedo12m": 67, "albedoarrai": 41, "albedoc": 41, "albedostagg": 67, "albeit": [8, 10, 16, 82], "alea": [8, 33, 34, 76, 77], "alfr": 63, "algorithm": [72, 73, 83], "align": [18, 39], "alk": 44, "all": [2, 6, 7, 8, 11, 12, 14, 15, 16, 20, 24, 25, 28, 29, 32, 36, 37, 38, 39, 40, 41, 42, 45, 46, 47, 48, 49, 53, 54, 55, 57, 60, 61, 62, 63, 68, 72, 73, 74, 77, 79, 83, 84, 85, 86, 87, 88, 91, 92], "all_cas": 44, "all_dim": [46, 68], "all_vari": 44, "alloc": [4, 12, 24], "allow": [7, 8, 14, 17, 23, 25, 29, 38, 44, 52, 62, 63, 71, 72, 81, 83, 86, 87, 88], "almost": [15, 87], "alon": 13, "along": [7, 8, 11, 17, 25, 30, 31, 35, 50, 59, 65, 68, 73, 74, 78, 80, 83, 87], "alpha": [65, 81], "alreadi": [7, 8, 11, 15, 16, 18, 25, 38, 39, 49, 50, 61, 68, 69, 72, 80, 81, 82, 83, 84, 87, 88], "also": [6, 7, 8, 10, 13, 15, 20, 23, 24, 28, 29, 31, 32, 35, 36, 37, 38, 39, 40, 41, 43, 44, 46, 47, 48, 56, 57, 59, 61, 62, 65, 67, 68, 70, 73, 74, 76, 78, 79, 80, 81, 84, 85, 86, 88, 89, 90, 92], "alt": 65, "altern": [33, 34, 44, 83, 86, 90], "although": [8, 18, 38, 42, 52, 59, 64, 87], "altunta": 61, "alwai": [8, 11, 12, 14, 15, 23, 25, 53, 74, 83, 87, 88], "am": [8, 11, 12], "amazon": 8, "among": [8, 88], "amount": [8, 14, 22, 37, 43, 52, 61, 79, 87], "amp": 83, "amwg": [8, 24, 41], "amwg_author": 41, "amwg_creation_d": 41, "amwg_diagnost": [8, 41], "amwg_obs_dataset": 41, "an": [0, 2, 4, 6, 7, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 21, 22, 24, 25, 29, 30, 31, 32, 35, 36, 37, 39, 42, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 57, 58, 59, 60, 62, 63, 64, 67, 68, 69, 70, 71, 74, 75, 78, 79, 80, 81, 82, 85, 86, 87, 88, 90, 92], "anaconda": [12, 30, 45], "anaconda3": [12, 45], "analyi": 71, "analys": [63, 73], "analysi": [2, 8, 10, 16, 18, 23, 25, 28, 29, 30, 31, 32, 37, 39, 43, 46, 47, 63, 67, 68, 70, 71, 77, 80, 81, 84, 85, 86, 90, 92], "analysis_config": 44, "analysisstagg": 67, "analyt": [2, 24], "analyz": [8, 32, 61, 87, 90], "ancillari": 47, "anderson": [2, 4, 8, 10, 11, 25, 26, 27, 32, 38, 46, 52, 66, 89], "andersy005": [4, 18, 25, 26, 27, 66], "angl": [67, 86], "anglestagg": 67, "ani": [7, 8, 12, 13, 14, 15, 20, 23, 36, 38, 44, 45, 46, 48, 50, 53, 62, 63, 68, 69, 71, 72, 75, 79, 83, 86, 87, 88, 90], "anissa": [8, 19, 34, 49, 76, 77, 91], "anissa111": [19, 34], "ann": 41, "ann_mean": 43, "annoi": [80, 86], "announc": [8, 27, 63], "annual": [8, 30, 31, 59, 61, 67, 81, 92], "annual_mean": 38, "anom": [46, 63], "anomali": [46, 63], "anomaly_cmip6": 46, "anomaly_smbb": 46, "anomalyhistori": 46, "anomalyparent_stat": 46, "anon": [38, 46, 68, 84], "anoth": [15, 17, 28, 31, 35, 39, 42, 47, 61, 63, 86, 88], "answer": [6, 8, 13, 25, 30, 31, 45, 47, 74], "anticip": 80, "anukesh": 87, "anyon": [8, 11, 16, 80, 82], "anyth": [8, 13, 14, 15, 29, 35, 45, 52, 69], "anywai": 74, "anywher": [11, 13, 14], "api": [8, 24, 25, 31, 38, 39, 62, 63, 67, 77, 80, 84], "apostroph": 14, "app": [22, 43, 52, 87], "appear": [7, 12, 28, 78, 86], "append": [13, 17, 18, 20, 39, 44, 61, 83], "appli": [8, 17, 24, 29, 36, 44, 46, 51, 61, 62, 63, 65, 68, 86], "applic": [2, 4, 8, 29, 57, 61, 62, 82, 83, 92], "apply_gufunc": 80, "apply_log10": 18, "apply_ufunc": [61, 73], "apply_unfunc": 47, "apply_variable_ufunc": 80, "apply_weight": 83, "applyin": 61, "appoint": [6, 7, 8], "appreci": 10, "approach": [2, 8, 23, 25, 29, 39, 71, 83], "appropri": [0, 7, 80, 86], "approv": [11, 79], "approx": 87, "approxim": [87, 90], "apr": [41, 87], "april": [7, 8, 21, 22, 55, 60, 83, 90], "ar": [0, 1, 2, 4, 6, 8, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 25, 26, 27, 28, 29, 31, 32, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 57, 58, 59, 60, 62, 63, 64, 65, 66, 67, 68, 69, 71, 72, 73, 74, 75, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92], "arang": [47, 53, 73, 80, 81], "arbitrai": 17, "arbitrari": [47, 80, 87], "arbitrarili": 47, "arc": 67, "archiv": [29, 42, 44], "arctic_grass": 80, "area": [23, 51, 61, 63, 72, 80, 83, 86, 88, 90], "area_a": [72, 83], "area_b": [72, 83], "areacello": 86, "areacello_bu": 86, "areacello_cu": 86, "areacello_cv": 86, "areacellocell_method": 86, "areastandard_nam": 86, "areasunit": 80, "aren": [8, 11, 13, 15, 29, 68, 81, 88], "arg": 80, "argentina": 40, "arguabl": [8, 64], "arguement": [25, 52], "argument": [11, 12, 15, 20, 31, 38, 39, 42, 48, 50, 53, 65, 71, 73, 74, 80, 83, 84], "ariabl": 38, "arm": 63, "arm_annual_cycle_twp_c2_cmbe_sound_p_f": 41, "aros": [8, 12, 13, 45, 48, 53], "around": [2, 7, 8, 10, 13, 14, 15, 16, 23, 24, 25, 30, 41, 42, 62, 63, 80, 83, 87, 90], "arrai": [7, 8, 11, 17, 18, 25, 28, 38, 39, 41, 43, 46, 53, 61, 62, 63, 65, 67, 68, 70, 72, 73, 81, 84, 86, 87], "arrang": 86, "arriv": 47, "arrow": [57, 88], "articl": [8, 17, 64, 80, 89], "artifact": 39, "artifici": 73, "as_compatible_data": 80, "as_numpi": 80, "ask": [8, 10, 15, 45, 57, 66, 75, 76, 77, 86, 90], "aso": 63, "aspect": [6, 25, 57, 63, 80], "aspir": [8, 59], "assembl": [8, 39, 42, 61], "assert": [11, 47, 61, 72, 83], "assert_allclos": [46, 68], "assert_equ": 80, "assert_ident": 17, "assertionerror": 17, "asset": [15, 18, 20, 25, 28, 31, 37, 38, 39, 41, 46, 61, 86, 92], "assign": [14, 18, 36, 37, 46, 50, 61, 64], "assign_attr": 81, "assign_coord": [7, 47], "assist": [6, 8, 16, 29, 88], "associ": [12, 29, 32, 38, 39, 63, 76, 86], "associated_fil": 86, "assum": [15, 35, 38, 47, 72, 80, 81], "assume_sort": 47, "assumpt": 87, "ast": [20, 28, 39, 41, 61], "asterisk": 45, "astronomi": 63, "astyp": [18, 37, 61, 80], "asymmetri": 67, "asynchron": [6, 78], "atla": 8, "atlant": 48, "atm": [7, 23, 28, 36, 37, 38, 41, 46, 51, 72, 83, 84, 86, 87], "atmintake_esm_attr": 38, "atmospher": [8, 11, 23, 28, 32, 37, 38, 40, 56, 59, 61, 72, 82, 83, 90], "atmosphere_hybrid_sigma_pressure_coordinateformula_term": [41, 72, 83, 84], "atmosphere_hybrid_sigma_pressure_coordinateunit": [38, 46, 84], "atoc8": [8, 12], "atown": 15, "attach": 71, "attempt": [7, 8, 15, 24, 42], "attend": [6, 8, 19, 21, 26, 27, 32, 40, 49, 54, 55, 62, 63, 85, 90], "attende": [8, 12, 32, 85, 90], "attent": [8, 49, 73, 76], "attornei": 15, "attr": [7, 39, 43, 47, 61, 65, 67, 80, 83], "attribut": [7, 8, 11, 15, 17, 20, 23, 28, 36, 37, 38, 39, 41, 46, 51, 61, 65, 67, 68, 70, 72, 73, 80, 81, 83, 84, 86, 87, 90], "attribute_nam": [20, 28, 41], "attrit": [8, 79], "audienc": [8, 82], "audio": 57, "aug": 23, "august": [7, 8, 26, 27, 34, 82], "aureliana": 25, "austin": [8, 54, 55], "australia": 67, "authent": 57, "author": [0, 15], "auto": [0, 7, 68], "autoclosebracket": 45, "autocomplet": 45, "autom": [4, 31, 38], "automat": [7, 8, 11, 12, 14, 15, 23, 44, 45, 69, 73, 80], "avail": [7, 8, 11, 20, 25, 29, 36, 37, 39, 46, 50, 57, 61, 64, 65, 69, 73, 74, 79, 80, 88, 89], "averag": [7, 8, 11, 20, 30, 32, 38, 43, 44, 53, 61, 63, 86, 87, 92], "average_dt": 86, "average_dtunit": 86, "average_op_ncl": 41, "average_t1": 86, "average_t2": 86, "average_weighted_temp": 68, "averagedconvent": 17, "avg": 83, "avg_period": 81, "avoid": [7, 11, 17, 29, 67, 73, 81, 83, 84, 86, 87], "avtiv": 55, "aw": [8, 18, 25, 36, 38, 46, 62, 68, 84], "awai": [10, 20, 24, 25, 29, 31, 86], "await": [8, 61, 79], "awar": 74, "ax": [37, 48, 68, 80, 81], "axhlin": 47, "axi": [7, 11, 37, 46, 48, 61, 72, 73, 80, 81, 83, 86], "axvlin": 47, "azjmpit9": 41, "b": [0, 7, 11, 15, 23, 28, 38, 40, 41, 46, 51, 61, 67, 68, 72, 73, 80, 83, 84, 86, 87], "b06a26fe6702": 86, "b1850": [28, 39, 44, 84, 87], "b1850c5": [23, 51], "b20trc5cn": 83, "b20trc5cnbdrd": [7, 38], "b37f404b": 83, "b8ab": 37, "b9e8": 73, "back": [6, 8, 10, 17, 20, 24, 42, 61, 63, 72, 73, 74, 83, 84], "backbon": 63, "backend": [20, 25, 28, 48, 61, 67, 84, 86], "backend_kwarg": 38, "backfir": 87, "background": [8, 11, 18, 45, 82], "backward": 29, "bad": [8, 15, 31, 45, 84], "badg": 64, "bag": 86, "balanc": [25, 41], "bam": [8, 46], "banihirw": [2, 4, 8, 10, 25, 26, 27, 32, 38, 46, 52, 66, 89], "bank": 15, "bar": [0, 7, 50, 88], "baranova": 61, "bare": 44, "barghini": 25, "barlei": 80, "barrier": [2, 77], "baschrc": 45, "base": [7, 8, 11, 17, 23, 24, 25, 30, 31, 35, 40, 43, 44, 45, 46, 47, 51, 61, 63, 64, 69, 72, 80, 81, 83, 84, 86, 90, 92], "base64": 86, "base_tim": 65, "baselin": [39, 86], "baseline_d": 39, "baseline_plot": 39, "bash": 12, "bash_profil": 12, "basi": [8, 28, 32], "basic": [7, 8, 16, 31, 35, 44, 45, 60, 62, 65, 75, 76, 77, 82, 83, 85], "basin": 18, "bat": 65, "batch": 8, "bb5b27d0821608d3fc5037525bd2f985t": 83, "bbf4": 83, "bcb991af9ed1": 37, "becasu": 87, "becaus": [8, 15, 16, 18, 43, 69, 72, 73, 74, 79, 80, 83, 86, 87, 90], "becom": [8, 10, 25, 29, 63, 64, 68, 81, 88], "bedrock": 80, "been": [0, 8, 11, 12, 20, 28, 29, 31, 32, 37, 38, 61, 73, 74, 80, 84, 87, 88], "befor": [0, 8, 12, 14, 16, 19, 21, 23, 26, 27, 37, 38, 39, 41, 44, 45, 49, 51, 55, 59, 61, 63, 66, 67, 72, 74, 75, 76, 77, 80, 81, 87, 88], "beforehand": 75, "began": [8, 29], "begin": [7, 8, 10, 13, 16, 35, 47, 48, 61, 62, 63, 80, 82, 84], "behav": [14, 53], "behavior": [45, 63], "behaviour": 87, "behind": [12, 63], "being": [6, 8, 11, 13, 14, 15, 20, 23, 24, 25, 29, 32, 37, 44, 45, 47, 59, 61, 66, 67, 68, 74, 80, 81, 88, 90], "believ": [8, 10, 15, 16, 90], "below": [8, 14, 18, 22, 30, 31, 32, 37, 38, 39, 42, 44, 51, 59, 62, 63, 64, 65, 67, 80, 81, 89, 91, 92], "benchmark": [8, 25, 32, 68], "benefici": [19, 21, 33, 49, 55], "benefit": [8, 10, 11, 23, 83, 84, 88], "bennett": 25, "benoit": 25, "berk": 63, "best": [2, 6, 7, 8, 10, 14, 29, 64, 83, 87], "beta": 24, "better": [8, 10, 15, 20, 29, 44, 63, 65, 71, 74, 80, 82], "betti": 63, "between": [2, 4, 8, 11, 14, 15, 39, 59, 61, 62, 67, 68, 74, 81, 88], "beyond": [2, 16, 24, 35], "bfe1": 68, "bgc": [7, 18], "bgcolor": 61, "bhist": 72, "bhistc5": 72, "bhistcmip6": 84, "bhistsmbb": 87, "bi": 6, "bia": [11, 63], "big": [2, 7, 10, 24, 25, 31, 40, 62, 63, 73, 87], "bigger": [80, 87], "bilinear": [72, 83, 90], "bilinear_1x777602_768x1152_peri": 72, "bilinearconvent": [72, 83], "bilinearxarrai": 72, "billion": 63, "bin": [12, 22, 29, 43, 45, 52, 87], "binari": [63, 65, 86], "binder": [8, 26, 27, 33, 34, 40, 56, 59, 66, 70, 78], "bio": 88, "biogeochemistri": [43, 44], "biogeochemistry_": 44, "biomass": [37, 46], "bit": [8, 10, 39, 61, 63, 65, 73, 80, 81, 86, 87], "black": [63, 80], "blank": 15, "blin": 38, "blind": 38, "block": [8, 12, 13, 15, 44, 50, 62, 74, 79, 80, 83, 86, 88], "blog": [1, 6, 8, 11, 17, 23, 25, 29, 39, 44, 50, 68, 73, 76, 77, 81, 83, 87, 88, 91], "blogpost": 87, "blue": 47, "bnd": [46, 87], "board": 63, "boat": 40, "bockelman": 91, "bodi": 15, "bog": 47, "bokeh": [20, 23, 38, 39, 41, 46, 61, 65, 67, 68, 84], "bolster": 10, "bonnland": 10, "book": [7, 88], "boolean": 15, "border": 23, "born": 10, "both": [2, 6, 8, 10, 20, 23, 24, 29, 30, 37, 41, 46, 50, 51, 59, 65, 67, 72, 74, 86], "bottleneck": [47, 73], "bottom": [12, 38, 41, 57, 67], "boulder": [8, 37, 63, 65, 82, 85], "bound": [7, 11, 38, 46, 61, 68, 81, 84, 86], "boundari": [12, 48, 63, 68, 86], "boundaries_chunks": 46, "boundariescalendar": 86, "boundsarrai": 61, "boundsunit": 84, "bovi": 25, "box": [8, 46, 67, 71], "boxplot": 30, "boxunit": 46, "boyer": 61, "br": 18, "bracket": [13, 15], "branch": [0, 8, 35, 37, 44, 61, 90], "branch_tag": 80, "break": [17, 23, 24, 63, 74, 77], "breakout": [24, 75, 77, 85, 90], "breindel": 62, "breviti": 17, "breweri": 40, "brian": [10, 32, 91], "bridg": 63, "brief": [6, 8, 15, 59, 90, 91], "bring": [8, 18, 24, 29, 30, 31, 88], "broad": 63, "broadcast_to": 41, "broaden": 2, "broader": [8, 63, 89], "broadleaf_deciduous_boreal_shrub": 80, "broadleaf_deciduous_boreal_tre": 80, "broadleaf_deciduous_temperate_shrub": 80, "broadleaf_deciduous_temperate_tre": 80, "broadleaf_deciduous_tropical_tre": 80, "broadleaf_evergreen_shrub": 80, "broadleaf_evergreen_temperate_tre": 80, "broadleaf_evergreen_tropical_tre": 80, "broadli": 29, "broke": 90, "brought": [8, 29, 30, 31], "browser": [1, 45, 50, 56], "bruyer": 67, "bruyerec": 67, "bsf": 44, "bssp370smbb": 87, "bsw": 80, "bu": 86, "bubbl": [36, 50], "budget": [10, 29, 38, 63], "buffer": 86, "bug": [8, 74, 80, 83, 90], "buggi": 73, "build": [2, 8, 23, 25, 29, 32, 36, 39, 45, 61, 63, 80, 81, 86, 90, 91, 92], "builder": [20, 28, 41], "built": [1, 8, 12, 18, 23, 28, 39, 41, 44, 50, 53, 63, 69, 73, 83], "bullet": 44, "bump": 86, "bunch": [31, 83], "burn": 46, "buseck": [4, 32], "busi": [15, 88], "button": [0, 21, 33, 34, 40, 50, 56, 58, 59, 60, 66, 70, 78], "bwr": 81, "by_coord": [7, 17, 87], "byte": [17, 38, 39, 41, 46, 61, 62, 67, 68, 72, 73, 80, 83, 84, 86, 87], "c": [7, 20, 23, 28, 36, 44, 45, 46, 47, 50, 52, 61, 63, 68, 71, 86], "c190529": 80, "c33f": 84, "c3_arctic_grass": 80, "c3_crop": 80, "c3_irrig": 80, "c3_non": 80, "c4_grass": 80, "c5c7baf9": 41, "c761": 86, "ca": 46, "cach": [30, 45, 86], "caco3_flux_100m": [18, 44], "cacti": 40, "calc": 63, "calc_wind_spe": 38, "calcul": [8, 20, 23, 24, 30, 31, 41, 44, 61, 63, 67, 73, 78, 80, 86, 90], "calendar": [8, 11, 28, 39, 40, 41, 46, 61, 68, 72, 79, 83, 84, 86, 87, 88], "calendar_typ": 86, "call": [7, 8, 12, 13, 14, 15, 28, 30, 31, 39, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 73, 79, 80, 83, 86, 87], "calucl": 81, "cam": [7, 8, 23, 28, 32, 37, 38, 41, 51, 72, 84, 87, 90], "cam5": 7, "camaraderi": [8, 88], "camcas": [23, 72, 83, 84, 87], "came": [8, 24, 64, 83, 90], "cami": 83, "campaign": [8, 20, 37, 40, 72, 83, 86], "camron": [2, 8, 32, 58, 78, 89, 91], "camtime_period_freq": 84, "camtitl": 38, "can": [0, 1, 4, 6, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 28, 29, 31, 35, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 50, 51, 53, 54, 57, 58, 59, 61, 62, 63, 64, 65, 66, 67, 68, 69, 71, 72, 73, 74, 75, 76, 77, 79, 80, 81, 83, 84, 86, 87, 88, 89, 90, 91], "canfra": 67, "cannot": [8, 11, 53, 57, 73, 80, 86, 87, 88], "canon": 69, "canopi": 67, "canva": 18, "capabl": [8, 17, 23, 24, 44, 72, 80], "capac": [2, 8, 17, 63, 88, 89], "captain": 40, "captial": 37, "caption": 44, "captur": 73, "carbon": 80, "care": [15, 45, 68, 81], "career": [40, 63], "carpentri": 25, "cart": 81, "cartesian_axi": 86, "cartopi": [8, 19, 23, 24, 31, 41, 43, 60, 80, 81, 92], "cartopy_tutori": 21, "case": [4, 7, 8, 12, 18, 20, 23, 25, 28, 31, 37, 38, 39, 41, 42, 43, 44, 46, 47, 50, 51, 61, 62, 68, 69, 72, 73, 77, 80, 81, 83, 84, 86, 87, 88, 90], "case_compare_d": 39, "case_compare_plot": 39, "case_data_path": 44, "case_i": 50, "case_titl": 80, "case_to_compar": 39, "casenam": [18, 39, 86], "casper": [4, 6, 7, 8, 25, 29, 30, 32, 37, 41, 43, 57, 62, 84, 87], "cassava": 80, "cat": [8, 28, 36, 37, 42, 74, 78], "cat_so": 42, "cat_thetao": 42, "catalog": [8, 25, 30, 31, 32, 38, 39, 42, 43, 44, 61, 86], "catalog_csv": 44, "catalog_fil": [42, 43], "catalog_json": 44, "catalog_subset": [38, 39, 46], "catalogu": 37, "catastroph": 63, "catch": [8, 16], "categori": [8, 29, 50, 67, 69], "categorydescript": 67, "categorystagg": 67, "catlaog": 39, "caus": [7, 14, 25, 45, 63, 68], "caution": 38, "cbar": 81, "cbar_kwarg": 80, "ccd4a03a": 84, "ccr": [23, 41, 43, 80, 83], "ccsm": [28, 39, 61, 68, 83], "cd": [0, 19, 26, 27, 33, 34, 40, 50, 55, 56, 66, 70, 78], "cdf": [41, 65], "cdf_d": 65, "cdf_kwarg": [20, 28, 39, 41, 43, 61], "cdg": 7, "cdi": 87, "cdo": 87, "cdx": 67, "cecil": 41, "ceilomet": 63, "cell": [0, 17, 18, 20, 38, 43, 45, 46, 48, 50, 53, 67, 68, 71, 73, 80, 86], "cell_area": [46, 86], "cell_areaunit": 86, "cell_corner_lat": 61, "cell_corner_lon": 61, "cell_measur": 86, "cell_method": [28, 38, 39, 41, 46, 61, 68, 80, 81, 84, 86, 87], "cell_typ": 44, "cells_to_keep": 44, "celsiu": [38, 65, 81], "center": [2, 6, 8, 24, 37, 39, 41, 56, 59, 61, 72], "centerarrai": 81, "centercom": 41, "centerconvent": 46, "centerposit": 86, "centerunit": 17, "centervers": 46, "centimet": [36, 61], "centimetersaxi": 61, "centimetersposit": [39, 61], "centimetersvalid_max": [61, 68], "central": 63, "centuri": 38, "cere": 41, "ceres2_01_cl": 41, "ceres2_01_climo": 41, "ceres2_04_climo": 41, "ceres_07_climo": 41, "cerfac": 42, "certain": [8, 23, 28, 86], "certainli": [8, 15, 74], "certif": 12, "cesm": [8, 20, 28, 29, 32, 37, 38, 39, 44, 46, 47, 51, 61, 67, 68, 72, 90], "cesm01host": 23, "cesm1": [36, 38, 43], "cesm1_1_2_len": 38, "cesm2": [8, 31, 32, 44, 47, 50, 72, 84], "cesm2_le_reference_fil": 84, "cesm2l": [46, 68], "cesm_data_catalog": 41, "cesm_data_catalog_subset": 41, "cesm_file_format": 44, "cesm_history_build": 20, "cesm_input": [84, 87], "cesm_monthly_mean_temperatur": 41, "cesm_monthly_temperature_plot": 41, "cesm_seasonal_mean_temperatur": 41, "cesm_seasonal_temperature_plot": 41, "cesm_test_catalog": 50, "cesm_test_data": 28, "cesm_timeseries_build": 20, "cesmdata": [61, 90], "cesml": [7, 36], "cf": [7, 8, 11, 17, 23, 28, 32, 38, 39, 46, 51, 61, 65, 67, 68, 72, 80, 83, 84, 87], "cf_xarrai": [7, 61], "cfad": 72, "cfnoleap_to_datetim": 11, "cft_irrigated_tropical_corn": 80, "cft_irrigated_tropical_soybean": 80, "cft_lb": 80, "cft_tropical_soybean": 80, "cft_ubctype_landic": 80, "cftime": [7, 17, 23, 38, 41, 43, 46, 61, 68, 72, 80, 83, 84, 86, 87], "cftime_rang": 30, "cftimeindex": [11, 72, 83, 84, 86, 87], "cgd": [2, 8, 10, 18, 28, 30, 31, 32, 37, 39, 47, 61, 68, 70, 80, 83, 86], "ch4": [72, 83, 84], "ch4vmr": [72, 83, 84], "chain": 73, "chair": 76, "challeng": [2, 8, 10, 16, 29, 41, 57, 67, 72, 74, 88], "champaign": 40, "chan": 63, "chanc": 90, "chang": [0, 1, 8, 12, 15, 19, 22, 26, 27, 35, 38, 42, 43, 45, 50, 52, 53, 61, 64, 67, 73, 90], "channel": [6, 7, 20, 29, 40, 91], "chapman": 77, "chapter": [12, 44], "charact": [14, 87], "character": 63, "chase": [8, 74], "chat": [8, 29, 57], "cheap": 73, "cheaper": 63, "check": [6, 7, 8, 12, 15, 18, 19, 21, 23, 24, 26, 27, 28, 29, 30, 31, 32, 35, 37, 39, 40, 43, 44, 45, 49, 50, 51, 53, 54, 55, 56, 57, 58, 59, 62, 63, 64, 65, 66, 68, 70, 73, 77, 78, 81, 84, 85, 87, 88], "checker": 4, "checkout": [0, 7, 20, 44], "cheet": 7, "chell": 25, "cherian": [2, 8, 17, 25, 32, 70, 76, 77, 89], "cherukuru": 91, "cheyenn": [8, 25, 29, 52, 57, 80], "cheyenneusernam": 80, "child": [8, 15, 36], "chill": 16, "chlorophyl": 43, "chmielowiec": [76, 77, 91], "choic": [7, 87], "choke": 69, "choos": [7, 12, 37, 41, 48, 50, 61, 88], "chore": 74, "chrome": 45, "chunk": [7, 8, 17, 20, 25, 28, 37, 38, 39, 41, 43, 46, 47, 61, 62, 67, 68, 72, 73, 80, 84, 86], "chunk_dict": 20, "chunk_slic": 17, "chunk_strategi": 20, "chunked_dim": 73, "chunksiz": [17, 28, 38, 39, 41, 43, 46, 47, 61, 67, 68, 72, 73, 80, 83, 84, 86, 87], "chunktyp": [41, 46, 68, 72, 73, 80, 83, 87], "churn": [8, 10], "cice": [18, 20, 28], "cindi": 67, "cisl": [2, 4, 6, 8, 10, 30, 31, 32, 43], "citat": 8, "cite": [8, 63], "citru": 80, "ckdtree": 51, "cl": 80, "clabel": 68, "clai": 67, "clarifi": 13, "clash": 14, "class": [8, 13, 32, 36, 60, 69, 72, 74, 83], "classroom": [75, 76], "classrooom": 77, "clat": 67, "clayfrac": 67, "clean": [12, 14, 16, 45, 65], "cleaner": 74, "clear": [14, 24, 39, 41, 47, 72, 87], "clearli": 15, "clearski": 36, "cleint": 62, "click": [0, 1, 6, 7, 12, 19, 21, 26, 27, 33, 34, 35, 40, 44, 49, 50, 52, 54, 55, 56, 57, 58, 59, 60, 62, 66, 70, 71, 78, 82, 88], "client": [8, 15, 17, 20, 22, 37, 38, 39, 41, 43, 46, 47, 52, 61, 62, 67, 68, 73, 84, 86, 87, 88], "clim": [68, 72], "climat": [8, 23, 36, 37, 38, 40, 41, 61, 62, 63, 73, 87], "climatenet": 83, "climatolog": 61, "climatologi": [20, 61, 80, 81, 92], "climatologiescdm_data_typ": 61, "climatology_averag": 81, "climatology_bound": 61, "climatology_boundsarrai": 61, "climo": 41, "climpr": 7, "clinic": 29, "clip": 7, "clipboard": [21, 58, 66], "clm2": 80, "clm5_param": 80, "clockwis": 86, "clone": [0, 19, 21, 26, 27, 28, 33, 34, 35, 40, 55, 56, 58, 66, 70, 78], "clong": 67, "clong_nam": 17, "close": [12, 15, 43, 46, 61, 63, 73, 79], "closer": 74, "closest": 37, "cloud": [8, 24, 25, 29, 31, 41, 46, 59, 86, 91], "cloudsat_10_climo": 41, "cloudsatcosp_07_climo": 41, "clue": 80, "cluster": [7, 8, 17, 22, 25, 41, 47, 52, 61, 63, 73, 86], "clyne": [2, 91], "cm": [28, 39, 61, 67, 68, 80], "cm6": 42, "cm_config": 45, "cmap": [23, 38, 39, 41, 61, 67, 68, 72, 81], "cmap_sequenti": 80, "cmip": [37, 41, 42, 72], "cmip6": [8, 25, 28, 32, 37, 41, 46, 68, 72, 84, 87], "cmip6_plot": 46, "cnrm": 42, "co": [8, 17, 46, 76, 85], "co2": [72, 83, 84], "co2vmr": [72, 83, 84], "coalesc": 29, "coars": 90, "coastlin": [23, 38, 41, 67, 72, 80, 81], "cocoa": 80, "code": [0, 2, 4, 6, 8, 12, 13, 15, 21, 23, 24, 25, 29, 32, 35, 40, 45, 47, 50, 58, 62, 63, 64, 66, 69, 71, 73, 80, 82, 83, 85, 87, 90], "code_obj": [37, 41], "codecel": 45, "coder": [8, 74], "coeff": 73, "coeffici": [46, 72, 73, 83, 84], "coffe": 80, "coil": [8, 62], "col": [20, 28, 36, 39, 42, 43, 46, 50, 65, 68, 72, 80, 83], "col_sub": 43, "cole": 63, "collabor": [2, 6, 8, 10, 24, 25, 29, 35, 37, 44, 46, 50, 59, 63, 77, 83, 85, 88, 92], "collaboratori": 63, "colleagu": [8, 15, 17, 88], "collect": [2, 7, 8, 12, 14, 29, 30, 32, 37, 38, 40, 41, 42, 43, 44, 61, 63, 65, 67, 68, 72, 78, 80, 84, 86], "collid": 10, "colobar": 68, "color": [43, 46, 48, 61, 62, 63, 65], "color_level": 61, "colorado": [8, 12, 37, 65, 82], "colorbar": [23, 31, 39, 48, 81], "colormap": [8, 23, 48, 61], "cols1d_act": 80, "cols1d_gi": 80, "cols1d_itype_col": 80, "cols1d_itype_lunit": 80, "cols1d_ixi": 80, "cols1d_jxi": 80, "cols1d_lat": 80, "cols1d_li": 80, "cols1d_lon": 80, "cols1d_wtgcel": 80, "cols1d_wtlunit": 80, "columbia": 32, "column": [8, 18, 20, 23, 28, 36, 37, 39, 41, 42, 46, 47, 51, 63, 65, 68, 80], "column_widget_typ": 18, "columncolab": 63, "columnflag_valu": 80, "com": [0, 12, 18, 19, 21, 23, 26, 27, 28, 33, 34, 35, 36, 38, 40, 46, 50, 55, 56, 58, 63, 66, 67, 70, 73, 78, 83, 87], "combin": [7, 8, 17, 20, 23, 44, 46, 61, 63, 67, 73, 84, 88], "combine_stream_jsons_as_group": 86, "combine_xxx": 87, "come": [8, 11, 25, 29, 41, 46, 47, 51, 59, 62, 63, 68, 74, 75, 76, 86], "comfort": 12, "comm": [37, 38, 41, 46, 61, 67, 68, 73, 83, 84, 86, 87], "comma": 14, "command": [8, 12, 21, 35, 45, 48, 55, 58, 60, 68], "commandnotfounderror": 12, "comment": [6, 17, 41, 45, 46, 61, 80], "commit": [0, 35, 88], "committe": 76, "common": [2, 7, 8, 13, 15, 30, 31, 32, 35, 36, 50, 57, 60, 62, 68, 72, 73, 74, 80], "commonli": [8, 73], "commun": [4, 8, 10, 11, 15, 20, 23, 25, 28, 29, 30, 36, 37, 41, 46, 59, 62, 64, 72, 77, 78, 83, 84, 87, 88, 90, 91], "comp": [7, 8, 34, 41, 77], "comp_i": [36, 50], "comp_tutori": 33, "compani": 15, "compar": [7, 8, 11, 32, 46, 47, 80, 81], "compare_case_nam": 44, "comparison": [8, 41, 44, 46, 62], "compat": [7, 20, 28, 41, 43, 61, 84, 87], "compil": [8, 12, 13, 14, 44, 45, 48, 53, 69, 77, 89], "complain": 80, "complement": 6, "complet": [8, 12, 13, 17, 22, 40, 59, 62, 63, 67, 71, 74, 75], "complex": [10, 25, 29, 62, 63], "compliant": [8, 67], "complic": [14, 80], "compon": [2, 8, 18, 20, 24, 25, 28, 37, 38, 39, 41, 46, 61, 62, 68, 86, 92], "componenthistori": 61, "componentintake_esm_varnam": 39, "componenttime_period_freq": 68, "compress": [20, 28, 38, 41, 86], "compressor": 86, "compris": [2, 8, 28, 31], "compset": 28, "comput": [2, 6, 7, 8, 10, 12, 16, 22, 23, 38, 43, 44, 47, 51, 53, 56, 59, 63, 67, 68, 72, 73, 74, 80, 84, 86, 88, 92], "computation": [43, 61], "compute_temp_100m": 43, "con": [15, 67], "concat": [18, 20, 39, 43, 46, 61], "concat_dim": [7, 65, 67, 84, 86, 87], "concaten": [7, 37, 39, 42, 43, 80], "concept": [15, 67], "conceptu": 25, "concern": [6, 88], "concurr": [20, 28, 71], "cond": [46, 68], "conda": [1, 8, 12, 15, 19, 21, 23, 26, 27, 28, 29, 33, 34, 36, 40, 44, 45, 49, 50, 52, 54, 55, 56, 58, 61, 66, 69, 70, 71, 72, 78, 83, 84, 86, 88, 91], "conda_environ": 21, "conda_prefix": 71, "conditionsstandard_nam": 41, "conduct": [40, 85], "confer": [8, 16, 88, 89, 90], "confess": 11, "config": [7, 12, 22, 37, 43, 44, 45, 52, 67, 84], "configmanag": 45, "configur": [8, 12, 20, 22, 43, 52, 71], "confirm": 53, "conflict": [0, 8, 15, 35, 79, 88], "conform": [43, 72], "confus": [8, 15, 88], "conjunct": [29, 65], "conl": 67, "connect": [6, 7, 8, 36, 37, 38, 41, 46, 57, 61, 63, 67, 68, 73, 83, 84, 86, 87, 88, 89], "conserv": [61, 90], "conservativexarrai": 61, "consid": [10, 11, 13, 25, 47, 68, 74, 77, 81, 84, 85, 86, 90], "consist": [6, 8, 14, 17, 38, 63, 67, 73, 88, 91], "consistentsgh": [23, 72, 83], "consolid": [8, 46, 76, 84, 86], "consolidate_metadata": 84, "conss": 67, "constant": 87, "constantli": 64, "constitut": 2, "construct": [8, 28, 31, 37, 38, 39, 41, 42, 46, 61, 63, 67, 69, 73], "consult": 6, "consum": 83, "consumpt": 73, "contain": [7, 11, 13, 14, 28, 29, 36, 39, 44, 45, 59, 61, 69, 71, 81, 83, 86, 92], "container": 29, "content": [1, 8, 15, 19, 21, 26, 27, 28, 31, 32, 33, 34, 35, 39, 40, 45, 49, 53, 55, 56, 58, 59, 61, 62, 63, 66, 68, 70, 71, 75, 77, 78, 89], "context": [2, 7, 8, 12, 15, 23, 38, 47, 61, 62, 71], "continu": [8, 10, 19, 21, 24, 25, 26, 27, 30, 33, 34, 35, 40, 47, 49, 54, 55, 56, 58, 59, 60, 62, 63, 66, 70, 74, 78], "contour": [61, 63, 81], "contourf": 81, "contract": 83, "contrast": [2, 87], "contrib": 7, "contribut": [0, 2, 6, 40, 63, 70, 82, 92], "contributor": [6, 8, 25, 59, 63, 88], "control": [12, 14, 37, 45, 61, 63, 81, 86, 87], "control_branch_year": [37, 41], "convect": [40, 87], "convei": [13, 23], "conveni": [8, 69, 72, 81, 92], "convent": [8, 11, 23, 28, 38, 39, 41, 46, 51, 61, 68, 72, 80, 83, 84, 87], "converg": 24, "convers": [6, 11, 24, 61, 63, 65, 80], "convert": [8, 11, 15, 18, 20, 25, 28, 29, 37, 39, 41, 45, 61, 63, 68, 73, 83, 84], "convert_pft_variables_to_spars": 80, "convert_pfts_to_spars": 80, "convex": 67, "convinc": 63, "convolut": [8, 15], "coo": [80, 83], "coo_matrix": 83, "cookbok": 86, "cookbook": [84, 86], "cookiecutt": 4, "cool": [8, 83, 89], "coord": [7, 20, 25, 28, 41, 47, 61, 73, 80, 83, 84, 87], "coordin": [2, 6, 7, 8, 11, 23, 24, 25, 28, 38, 39, 41, 43, 46, 47, 51, 61, 63, 65, 67, 68, 70, 72, 73, 80, 81, 84, 86, 87], "cope": 63, "copi": [6, 7, 12, 21, 53, 57, 58, 59, 65, 66, 71, 72, 80, 83, 86, 87], "cora": 91, "core": [7, 8, 17, 20, 22, 23, 25, 37, 39, 41, 42, 43, 46, 47, 52, 67, 72, 73, 80, 84, 86, 87, 88, 91], "corioli": [67, 86], "corn_lat": 61, "corn_lon": 61, "corner": [0, 50, 57, 59, 61, 67, 68, 86], "corner_lon": 67, "cornersr_x": 67, "cornersstagg": 67, "cornerston": 2, "correct": [11, 47, 63, 68, 74, 75, 80], "correct_plot": 68, "correctli": [7, 8, 30, 43, 49, 50, 55, 67, 87], "correspond": [17, 39, 42, 46, 61, 67, 68, 71, 80], "corrupt": 43, "cos_rot": 86, "cosalpha": 67, "cosalpha_u": 67, "cosalpha_v": 67, "cosin": [67, 86], "cosp": 72, "cosp_ht": 72, "cosp_ht_bnd": 72, "cosp_ht_bndsarrai": 72, "cosp_htpandasindexpandasindex": 72, "cosp_pr": 72, "cosp_prs_bnd": 72, "cosp_prs_bndsarrai": 72, "cosp_prspandasindexpandasindex": 72, "cosp_scol": 72, "cosp_scolpandasindexpandasindex": 72, "cosp_sr": 72, "cosp_sr_bnd": 72, "cosp_sr_bndsarrai": 72, "cosp_srpandasindexpandasindex": 72, "cosp_sza": 72, "cosp_szapandasindexpandasindex": 72, "cosp_tau": 72, "cosp_tau_bnd": 72, "cosp_tau_bndsarrai": 72, "cosp_taupandasindexpandasindex": 72, "cote": 91, "cotton": 80, "could": [8, 10, 12, 13, 15, 20, 25, 28, 29, 38, 41, 45, 46, 47, 52, 61, 62, 67, 68, 69, 72, 73, 75, 79, 80, 83, 86, 87, 90], "couldn": [10, 11], "count": [12, 17, 36, 38, 39, 41, 46, 50, 61, 67, 68, 73, 80], "coupl": [8, 10, 28, 30, 38, 39, 50, 63, 67], "coupler": 61, "cours": [15, 32, 62, 74], "cover": [8, 12, 14, 16, 29, 34, 44, 47, 50, 52, 59, 61, 62, 63, 67, 68, 69, 76, 77, 81, 82, 85, 88], "cowork": [8, 11], "cpl": [28, 61], "cpl6": 61, "cpres0": 65, "cpu": [23, 28, 46, 47, 51, 67, 68, 83, 84, 86], "cr": [23, 41, 43, 61, 80, 81], "craft": 15, "craker": [2, 32, 76, 77], "crawl": 28, "cre": 41, "creat": [0, 1, 4, 6, 8, 12, 13, 14, 15, 16, 18, 19, 20, 21, 23, 24, 26, 27, 28, 31, 32, 33, 34, 35, 37, 40, 41, 43, 44, 45, 46, 48, 49, 51, 52, 53, 54, 55, 56, 58, 61, 63, 66, 67, 68, 69, 70, 71, 72, 73, 78, 80, 81, 82], "create_cmap": 61, "create_dashboard": 18, "create_filepath": 17, "creation": 23, "creator": 64, "creatur": 74, "credit": [8, 63, 64], "creep": [8, 47, 74], "criterion": 47, "critic": [2, 8, 17, 25, 41], "crop": 80, "cropscap": 63, "croptyp": 63, "cross": [7, 8, 24, 63, 90], "crsunit": 61, "cru": 46, "cseg": [61, 80, 90], "csg": 6, "csm": [72, 83], "csmdomain_a": [72, 83], "csv": [20, 28, 41, 44, 46, 63], "csv_kwarg": [20, 28, 39, 41, 61], "ctrl": [12, 36, 45], "ctsm": 24, "cu": [63, 68, 86], "cube": 72, "culmin": [2, 77], "cultur": 2, "cupi": [25, 80], "cupid": 91, "curat": [25, 44], "curios": [24, 44], "curiou": [8, 50, 88], "curious": 10, "curl": [8, 12], "currenc": 2, "current": [4, 6, 8, 10, 12, 15, 24, 25, 28, 38, 39, 46, 47, 59, 61, 68, 72, 80, 83, 84, 92], "curriculum": 63, "curv": 29, "curveplot00876": 84, "curveplot00983": 84, "curvilinear": 72, "custom": [80, 88], "custom_plot": 81, "customari": 65, "cut": 41, "cutoff": 46, "cv": 86, "cvdp": 24, "cvmix": 86, "cvs_revis": [72, 83], "cyclic": 74, "cyclon": [90, 91], "d": [0, 6, 7, 8, 11, 15, 17, 20, 23, 24, 37, 38, 39, 41, 43, 45, 46, 47, 51, 61, 63, 65, 67, 68, 79, 81, 84, 86, 87, 90], "d1280585": 67, "d2": 68, "d67h1h0v": [28, 39, 61, 68, 84, 87], "d67h1h0vcell_method": 39, "d67h1h0vconvent": 61, "d67h1h0vrevis": 68, "d67h1h0vsourc": 84, "d67h1h0vtime_period_freq": [84, 87], "d92edee1": 61, "da": [11, 37, 39, 41, 46, 73, 80, 83], "da6eb586": 73, "dagon": [2, 76, 77], "dai": [8, 10, 11, 25, 28, 38, 39, 42, 46, 61, 62, 63, 67, 68, 72, 75, 76, 77, 80, 81, 83, 84, 86, 88, 90, 91], "daili": [4, 8, 28, 36, 37, 65, 68, 81, 84, 86, 87], "dailyoutput_mod": 17, "damien": 25, "damon": [8, 90], "dan": 91, "danger": 29, "daniel": [2, 91], "darkblu": 65, "dashboard": [7, 8, 17, 20, 22, 37, 38, 39, 41, 43, 46, 47, 52, 61, 63, 67, 68, 73, 83, 84, 86, 87], "dask": [6, 8, 10, 24, 28, 41, 44, 46, 47, 61, 63, 67, 68, 71, 72, 83, 84, 85, 86, 91], "dask_gufunc_kwarg": [61, 80], "dask_jobqueu": [8, 22, 38, 43, 46, 61, 68, 83, 84, 87], "dasker": 25, "dasky_arrai": 80, "data": [2, 3, 6, 10, 11, 12, 13, 15, 16, 17, 20, 24, 25, 36, 40, 42, 44, 48, 50, 51, 53, 59, 60, 64, 69, 71, 73, 78, 80, 82, 84, 88, 90, 91, 92], "data_catalog": [38, 61], "data_catalog_subset": 61, "data_fil": [72, 83], "data_format": [20, 28, 41], "data_in": 72, "data_out": 83, "data_path": 83, "data_process": 83, "data_var": [7, 43, 61, 84, 87], "dataarrai": [7, 11, 39, 41, 46, 47, 61, 65, 67, 68, 72, 73, 81, 83, 87], "dataarrayi": 80, "dataarraylat": 83, "dataarraylon": 83, "dataarraymember_id": 68, "dataarrayocean_tim": 73, "dataarrayseason": 81, "dataarraytim": [65, 80], "dataarrayvegtyp": 80, "dataarrayx": 80, "databas": [8, 43, 61], "datafil": [12, 13], "datafram": [18, 20, 23, 28, 36, 41, 42, 50, 59, 62], "datarefer": 61, "datarrai": 61, "dataset": [2, 6, 7, 8, 10, 11, 20, 25, 28, 29, 30, 31, 36, 38, 42, 51, 61, 62, 63, 65, 68, 71, 72, 73, 80, 81, 83, 84, 91, 92], "dataset_titl": 46, "datasetdimens": [17, 23, 38, 39, 41, 46, 61, 65, 67, 68, 72, 73, 80, 83, 84, 86, 87], "datasetset": 41, "datasetview": 86, "datashad": [8, 32, 39, 83], "datastor": [37, 41, 42], "datatreegroup": 86, "date": [0, 8, 11, 15, 18, 20, 28, 30, 39, 41, 42, 61, 72, 80, 83, 84], "date_cr": 61, "date_modifi": 61, "date_written": [28, 72, 80, 83, 84], "datepalm": 80, "datesec": [28, 72, 83, 84], "datetim": [11, 15, 41, 46, 61, 73, 81, 84], "datetime64": [46, 65, 67, 81], "datetimeindex": [11, 65, 81], "datetimenoleap": [7, 17, 23, 38, 46, 68, 72, 80, 83, 84, 86, 87], "dateunit": 80, "daunt": 67, "dav": [22, 37, 41, 43, 52, 87], "dave": 91, "davi": 25, "david": 32, "day_1": [20, 84, 87], "day_1histori": 87, "day_1topography_fil": 84, "day_1xarrai": 84, "daylight": [8, 26, 27, 33, 34, 66], "dayofyear": 11, "days_in_month": 68, "dcherian": [25, 73, 80, 84, 86, 87], "dcpy": 80, "dd": 11, "de": [29, 87], "deactiv": 7, "deadtim": 63, "deal": [8, 11, 16, 23, 25, 28, 35, 37, 43, 51, 63, 82], "dear": 15, "debug": [8, 28, 32, 62, 81, 90], "dec": 17, "decad": [31, 61], "decav": 61, "decemb": [7, 8, 40, 65, 68, 81], "decid": [8, 15, 16, 74], "decis": [29, 87], "declar": [13, 15], "declin": 32, "decod": [11, 80, 86], "decode_cf": 11, "decode_tim": [41, 43, 61, 80], "decor": 38, "decreas": 47, "dedic": [8, 10, 24, 25], "deep": [62, 63, 67, 86], "deepak": [2, 8, 17, 25, 32, 70, 76, 77, 89, 90], "deepcopi": 86, "deeper": [2, 8, 62, 75, 76, 88], "deepest": 47, "def": [11, 17, 20, 23, 37, 38, 39, 41, 43, 44, 46, 47, 51, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "default": [12, 14, 15, 28, 29, 39, 45, 52, 62, 68, 72, 80, 86, 87, 88], "default_cache_typ": 84, "default_fill_cach": 84, "defici": 2, "defin": [12, 13, 14, 15, 24, 38, 47, 61, 62, 63, 65, 69, 86], "definit": [14, 38, 62, 69], "deg": 73, "deg_coord": 73, "degc": [36, 37, 61, 65, 68, 81, 86], "degcgrid_loc": [39, 61], "degclong_nam": 46, "degcprecis": 81, "degcxarrai": 68, "degf": 65, "degre": [8, 18, 37, 38, 61, 63, 65, 67, 72, 73, 81, 83], "degree_dim": 73, "degrees_celsiu": 61, "degrees_celsiusxarrai": 61, "degrees_east": [23, 61, 72, 80, 83, 84, 86], "degrees_eastactual_rang": 46, "degrees_eastarrai": [38, 39, 41, 46, 61, 80, 84, 86], "degrees_eastaxi": [61, 87], "degrees_eastbound": [17, 84], "degrees_eastgeospatial_lon_resolut": 61, "degrees_eastlong_nam": [41, 81], "degrees_eastvalid_rang": 41, "degrees_north": [23, 61, 72, 80, 83, 86], "degrees_northactual_rang": 46, "degrees_northarrai": [38, 39, 41, 46, 61, 80, 84, 86], "degrees_northaxi": [61, 87], "degrees_northbound": 17, "degrees_northgeospatial_lat_resolut": 61, "degrees_northlong_nam": [41, 81], "degrees_northvalid_rang": 41, "degreesarrai": 72, "degreesgeospatial_lon_unit": 61, "degreesgeospatial_vertical_unit": 61, "degreesummari": 61, "delai": [25, 84, 86], "delaunai": 23, "delavan": 40, "deleg": 2, "delet": [12, 17, 30, 35, 43], "deliv": 2, "deliveri": 6, "delta": 81, "delta_t": 81, "demand": 88, "demo": [6, 35], "demonstr": [8, 11, 44, 46, 71, 72, 83, 84], "denni": 72, "denomin": 68, "dens": [8, 80], "densifi": 80, "densiti": [25, 47], "depart": [8, 90], "depend": [6, 11, 29, 38, 43, 44, 47, 52, 62, 63, 87], "dependent_vari": 38, "deploi": [18, 25, 44, 63], "deploy": 2, "deprec": [68, 87], "depriv": [8, 15], "depth": [8, 20, 28, 39, 41, 50, 61, 67, 68, 73, 86], "depth_bnd": 61, "depth_bndsposit": 61, "depthbound": 61, "deptho": 86, "depthstagg": 67, "depthstandard_nam": 86, "depthunit": 72, "derecho": [4, 7], "deriv": [8, 31, 44, 53, 67], "derived_vari": 38, "derivedvari": 38, "derivedvariableregistri": 38, "describ": [2, 8, 28, 37, 46, 50, 59, 61, 73, 80, 86], "descript": [0, 6, 37, 50, 67, 69, 86, 88, 90], "deserv": [8, 64], "design": [6, 8, 10, 15, 16, 23, 25, 47, 56, 70, 75, 78, 82], "desir": [6, 13, 44, 48, 52, 59], "despit": [2, 8, 74], "destarea": [72, 83], "destareamap_method": [72, 83], "destin": 61, "detail": [4, 7, 8, 10, 11, 28, 29, 32, 35, 37, 39, 50, 52, 57, 64, 81, 84, 85, 86, 88], "detect": [12, 73, 80], "determ": 61, "determin": [8, 12, 14, 28, 45, 47, 59, 65, 68], "detrend": [8, 67], "detrend_dim": 73, "dev": [7, 25, 38, 41, 61, 63, 67, 68, 83], "dev056revision_id": 80, "develop": [2, 4, 8, 10, 20, 25, 29, 31, 33, 34, 50, 56, 57, 59, 60, 61, 64, 67, 74, 78, 80, 83, 84, 88, 90, 91, 92], "deviat": [61, 67, 81], "devlop": 25, "dewpoint": 65, "dewpoint_plot": 65, "df": [18, 20, 28, 36, 37, 39, 41, 42, 43, 46, 50], "df_histori": 20, "df_list": 18, "df_timeseri": 20, "di": 62, "diagnos": 47, "diagnost": [4, 8, 18, 25, 28, 31, 32, 38, 41, 61, 63, 68, 86], "diagnot": 32, "diagraph": 50, "dialog": 7, "diatc": 43, "diatchl": 43, "diaz_nfix": 44, "dic": 44, "dict": [17, 41, 44, 47, 80, 83, 84, 86], "dict_kei": [37, 39, 41, 46, 61, 86], "dictionari": [8, 13, 15, 16, 18, 28, 37, 38, 41, 42, 43, 44, 46, 47, 61, 82], "did": [11, 12, 19, 21, 26, 27, 41, 49, 54, 55, 84, 90], "didn": [8, 15, 46, 51, 63, 72, 74, 83, 87, 90], "die": 25, "diff": [39, 46, 81], "diff_perc": 39, "differ": [2, 4, 7, 8, 11, 12, 14, 15, 16, 18, 24, 25, 28, 31, 36, 39, 41, 44, 45, 50, 53, 61, 62, 63, 65, 69, 71, 74, 80, 82, 83, 86, 87, 88, 89, 90], "difference_plot": [39, 68], "difference_plot_perc": 39, "difficult": [8, 11, 23, 28, 42, 50, 61, 62, 63, 64, 67, 71], "difficulti": [59, 79], "diffus": 86, "dig": [8, 43, 68], "digit": [63, 64], "digraph": [36, 50], "dim": [17, 20, 28, 31, 39, 41, 43, 46, 47, 51, 61, 68, 72, 73, 80, 83, 87], "dim_avg_n": 41, "dimens": [7, 8, 11, 17, 23, 28, 31, 38, 39, 41, 46, 47, 51, 61, 65, 67, 68, 70, 72, 73, 81, 84, 86, 87], "dimension": [8, 47, 70, 80], "dimension0003": 67, "dimension0012": 67, "dimension0016": 67, "dimension0021": 67, "dimension0132": 67, "dimensionlessdescript": 67, "dimlst": 83, "dims_in": [47, 72], "dir": [37, 41, 67], "direct": [6, 8, 24, 36, 49, 61, 63, 67], "directionstagg": 67, "directli": [6, 8, 12, 18, 20, 23, 31, 39, 43, 50, 67, 80], "directori": [8, 18, 19, 21, 22, 26, 27, 37, 39, 40, 41, 43, 44, 45, 52, 55, 56, 57, 58, 65, 66, 69, 70, 73, 78, 84, 86, 87], "directorystor": 86, "disabl": 45, "disc": [45, 86], "discard": 13, "disciplin": [2, 62, 63], "disciplinari": 2, "disconnect": 29, "discourag": [8, 74], "discours": [2, 7, 44], "discoveri": 31, "discrep": 81, "discret": 64, "discrete_slid": 18, "discuss": [6, 7, 8, 29, 39, 59, 76, 77, 81, 83, 85, 86, 90], "dishearten": [8, 74], "disk": [17, 20, 37, 61, 62, 73, 80, 84, 86], "dispatch": 83, "displai": [12, 15, 20, 72, 73, 80, 83], "disrupt": 2, "distinct": 11, "distribut": [7, 8, 17, 20, 22, 32, 37, 38, 39, 41, 43, 46, 52, 61, 63, 67, 68, 73, 84, 86, 87], "distributiontime_coverage_start": 61, "div": 18, "dive": [59, 62, 63, 75, 76], "divers": [2, 8, 63, 88], "divid": 46, "divis": 14, "django": [8, 15], "djf": [41, 81], "dll": 80, "dllversion": 80, "do": [0, 1, 6, 8, 10, 11, 12, 13, 14, 15, 19, 20, 21, 23, 25, 26, 27, 30, 31, 33, 34, 35, 38, 39, 44, 45, 46, 48, 49, 50, 53, 54, 55, 56, 57, 58, 60, 61, 62, 63, 65, 66, 68, 69, 70, 71, 72, 73, 74, 75, 77, 78, 80, 81, 82, 83, 86, 87, 88, 89, 90], "doc": [7, 8, 29, 30, 44, 62, 68, 73, 75, 76, 86, 87], "docr": 44, "docstr": 17, "document": [2, 4, 6, 7, 8, 11, 15, 17, 24, 25, 28, 29, 31, 37, 42, 44, 48, 51, 53, 57, 61, 62, 63, 64, 65, 67, 70, 71, 78, 83], "dods_extra": 46, "dodsc": 46, "doe": [10, 11, 12, 13, 14, 15, 20, 29, 44, 45, 46, 47, 48, 50, 61, 69, 73, 83, 84, 86, 87, 90], "doesn": [8, 12, 29, 38, 45, 73, 81, 83, 87, 88], "doi": [8, 28, 29, 39, 46, 61, 68, 84, 87], "dokku": 18, "domain": [8, 23, 25, 47], "domain_a": [72, 83], "domain_b": [72, 83], "domin": 67, "don": [7, 12, 14, 15, 25, 29, 45, 63, 69, 74, 88, 89], "done": [8, 11, 12, 20, 21, 23, 24, 28, 29, 46, 47, 50, 58, 66, 69, 71, 87, 88], "doppler": 63, "dot": [8, 36, 48, 50, 72, 83], "doubl": [23, 28, 45, 50, 57, 71, 88], "doubletime_rep": 17, "down": [7, 8, 24, 25, 28, 45, 47, 59, 61, 74, 77, 88], "downcreator_nam": 61, "download": [8, 12, 24, 40, 45, 56, 59, 61, 65, 66, 70, 78], "downsid": 86, "downstandard_nam": [38, 41, 46, 72, 83, 84], "downunit": [61, 68, 86], "downvalid_min": [39, 61], "downvot": 74, "dp": 65, "dpi": [48, 80], "dr": [8, 56, 85], "draft": 17, "draw": [76, 81], "drawback": 71, "dream": 10, "drew": [2, 8, 32, 58, 78, 89, 91], "drive": [2, 15], "driven": [6, 8, 10, 24, 44], "driver": 24, "drop": [7, 18, 30, 43, 46, 47, 57, 61, 65, 83, 86], "drop_dim": 83, "drop_tim": 86, "drop_var": [72, 83], "dropna": 46, "ds277": 81, "ds_ann": 43, "ds_first_five_year": 68, "ds_in": [61, 72], "ds_list": 39, "ds_out": [43, 61, 72], "ds_read_directli": 84, "ds_standard_unit": 65, "ds_to_plot": 67, "ds_whole": 47, "dset": [20, 28, 37, 38, 39, 41, 42, 43, 46, 61], "dset_dict": 42, "dset_dict_so": 42, "dset_dict_thetao": 42, "dset_list": 61, "dsets2": 43, "dsigma": 47, "dso": 83, "dst": 83, "dst_grid_dim": [72, 83], "dst_grid_rank": [72, 83], "dstlat": 83, "dstlon": 83, "dsw": 83, "dt": 68, "dtype": [7, 11, 17, 18, 23, 37, 38, 39, 41, 46, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "dtypewarn": [37, 41], "du": 23, "dual": [8, 15, 57, 88, 90], "duck": [25, 74], "duck_array_op": 83, "due": [8, 13, 29, 67, 83], "dummi": [72, 83], "dummy_in": [72, 83], "dummy_out": [72, 83], "dump": [63, 84, 86], "duplic": [29, 45, 63], "durat": 15, "dure": [6, 8, 12, 13, 14, 16, 23, 24, 28, 30, 31, 40, 45, 48, 53, 61, 62, 64, 76, 77, 78, 79], "dvr": 38, "dynam": [40, 72], "dz": 43, "dzlake": 80, "dzsoi": 80, "e": [0, 6, 8, 10, 13, 14, 15, 23, 28, 38, 43, 45, 49, 51, 54, 61, 67, 71, 72, 80, 81, 86, 87, 90], "e11": [7, 38], "e1214b55": 84, "e13": [72, 83], "e20": [28, 61], "e21": [84, 87], "e22": [18, 20], "e23": 86, "e3a9b95111fb": 87, "e3sm": 24, "e503263520abd161067be1f5e311c2e1gpp": 80, "e622b658eb45": 84, "each": [2, 6, 7, 8, 11, 12, 13, 15, 16, 17, 24, 28, 29, 36, 37, 39, 40, 46, 47, 50, 53, 59, 61, 62, 63, 64, 65, 67, 68, 69, 71, 75, 76, 77, 80, 81, 83, 86, 87, 90], "eager": 74, "earli": [8, 11, 32, 90], "earlier": 23, "earth": [2, 3, 6, 20, 24, 28, 29, 30, 31, 36, 37, 40, 41, 46, 56, 59, 63, 88, 91], "earthcub": [24, 59], "eas": [28, 46], "easi": [8, 15, 23, 24, 25, 29, 61, 71, 72, 73, 74, 81, 86], "easier": [6, 8, 12, 16, 23, 24, 25, 39, 46, 50, 51, 52, 57, 61, 63, 67, 68, 74, 78, 81], "easiest": [15, 29, 45, 62], "easili": [2, 8, 15, 17, 23, 28, 29, 41, 47, 52, 71, 80], "east": 41, "east_grid_dimens": 67, "east_patch_end_stag": 67, "east_patch_end_unstag": 67, "east_patch_start_stag": 67, "east_patch_start_unstag": 67, "eastern": 81, "eaton": [28, 39, 61, 68], "ebaf": 41, "ebaf_01_climo": 41, "ebb8a0fc": 86, "ecgtool": [8, 32, 39, 50], "ecmwf_09_climo": 41, "ecocystem": 44, "econom": 63, "ecosi": 18, "ecosystem": [8, 24, 25, 29, 30, 31, 32, 39, 43, 50, 59, 61, 62, 63, 67, 70, 72, 89], "ecoysystem": 44, "ed": 61, "edg": [36, 50], "edgecolor": 81, "edif": 15, "edit": [0, 8, 18, 45, 52, 66, 69, 88], "editor": [12, 57, 69], "edu": [8, 12, 18, 19, 21, 22, 26, 27, 28, 33, 34, 35, 37, 38, 39, 40, 41, 43, 46, 49, 52, 54, 55, 56, 57, 58, 60, 61, 62, 66, 67, 68, 70, 75, 78, 82, 83, 84, 86, 87, 88], "educ": [8, 16, 32, 59, 74, 78], "edwardsj": 72, "effect": [2, 6, 8, 10, 16, 23, 30, 31, 41, 45, 59, 61, 67, 73, 84], "effici": [2, 8, 29, 31, 68, 86, 88], "effient": [8, 70], "effort": [2, 6, 8, 24, 25, 29, 44, 63, 64, 80], "eg": 85, "egistri": 38, "einsum": 83, "either": [14, 23, 35, 44, 50, 68], "elaps": [20, 28], "element": [8, 13, 15, 53, 63, 72, 80, 83, 90], "elena": [76, 77, 89], "elif": [41, 80], "elimin": 63, "els": [13, 17, 25, 41, 47, 57, 74, 80, 81, 86], "elsewher": [7, 86], "email": [7, 8, 12, 15, 85, 88], "embarassingli": [8, 47], "embed": [40, 62], "embrac": 2, "emc2": 63, "emerg": [2, 6], "emm": 91, "emma": 89, "empathet": [8, 74], "emphasi": 24, "employe": [25, 63], "empow": 25, "empti": [13, 15, 18, 46, 63, 69, 72, 80, 83, 86], "enabl": [2, 8, 20, 25, 29, 31, 37, 38, 39, 43, 59, 61, 71, 84, 88, 92], "encapsul": 2, "enclos": 15, "encod": [7, 11, 43, 80, 84, 86, 87], "encount": [8, 11], "encourag": [2, 8, 23, 30, 44, 59, 77, 85, 90, 91], "end": [0, 7, 8, 12, 13, 14, 17, 20, 24, 25, 42, 48, 50, 61, 62, 65, 67, 72, 73, 81, 86, 87, 90], "end_tim": [20, 36, 37, 38, 46, 61], "endblock": 15, "endif": 15, "endpoint": [38, 72, 80, 83, 84], "endpointsarrai": 23, "energi": [8, 41, 90], "engag": [2, 59, 63], "engin": [2, 4, 8, 10, 15, 17, 29, 40, 56, 63, 65, 67, 79, 82, 84, 86], "enhanc": [6, 8, 88], "enjoi": [40, 90], "enorm": [8, 10], "enough": [7, 31, 62, 63, 81, 90], "ensembl": [8, 31, 36, 37, 38, 41, 43, 47, 68, 84, 87], "ensur": [8, 23, 24, 25, 29, 39, 43, 50, 57, 66, 71], "enter": [52, 57, 71], "enterpris": 91, "enthought": 63, "entir": [8, 12, 15, 20, 23, 25, 42, 45, 46, 61, 73], "entrain": [2, 25, 59], "entri": [2, 80, 86], "env": [1, 7, 15, 19, 21, 26, 27, 28, 33, 34, 37, 38, 40, 41, 45, 55, 58, 61, 66, 67, 68, 70, 71, 78, 80, 84, 87], "env_extra": 84, "env_nam": 12, "enviro": 71, "environ": [1, 2, 12, 15, 19, 21, 25, 26, 27, 28, 29, 30, 33, 34, 40, 45, 49, 50, 54, 55, 56, 58, 66, 67, 69, 70, 78, 83, 85, 88], "environment": 61, "envnam": 49, "eo": 47, "eof": [7, 48], "eol": 2, "ep": [41, 48], "epsg": 61, "equal": [7, 28, 41, 61, 67, 68, 81, 87], "equiangular": 72, "equip": [6, 29], "equitori": 81, "equival": [13, 53, 67, 84], "erai_04_climo": 41, "erai_djf_climo": 41, "erbe_07_climo": 41, "eriv": 38, "erod": 67, "erodstagg": 67, "eroglu": [2, 30, 32, 76, 77, 91], "error": [6, 7, 8, 11, 12, 23, 43, 45, 46, 47, 60, 61, 68, 73, 80, 81, 83, 84], "ers_12_climo": 41, "esd": [4, 7, 24, 28, 39, 50, 64, 68, 73, 79, 83, 90, 92], "esm": [8, 30, 31, 32, 44, 61, 86], "esmf": [8, 72, 83], "esmf_regrid_method": [72, 83], "esmf_regridweightgen": 83, "esmlab": 43, "esmpi": 83, "esp": [28, 31], "especi": [7, 8, 25, 28, 29, 36, 62, 64, 65, 67, 74], "espwg": 20, "esrl": 46, "essenti": [2, 7, 8, 11, 14, 15, 23, 25, 31, 39, 60, 62, 75, 80, 86], "establish": 63, "estim": 59, "et": [8, 17, 31, 37, 72], "eta_rho": 73, "etc": [6, 7, 8, 10, 13, 20, 28, 29, 38, 44, 63, 69], "europ": 63, "evalu": [15, 24, 38, 40, 64, 73, 92], "even": [6, 8, 12, 15, 25, 28, 29, 41, 42, 61, 63, 64, 69, 74, 84, 86, 87, 88], "event": [6, 8, 16, 19, 21, 26, 27, 32, 33, 34, 35, 49, 54, 55, 56, 58, 60, 63, 66, 70, 75, 77, 78, 82, 88, 90], "eventu": [8, 74, 79], "ever": [69, 88], "everi": [6, 8, 11, 12, 13, 14, 15, 24, 28, 42, 44, 45, 63, 65, 79, 80, 81, 82, 83, 86, 87], "everyon": [76, 91], "everyth": [13, 14, 15, 25, 36, 47, 57, 73], "evolut": [29, 63], "evolv": [61, 63, 64], "ex": [7, 8, 24, 25, 28, 29, 31, 36, 37, 41, 43, 44, 59, 62, 63, 64, 67, 68, 84], "exactli": [15, 28, 39, 61, 68], "examin": [8, 23, 32, 36, 44, 73, 80], "exampl": [4, 6, 7, 8, 10, 11, 12, 13, 14, 15, 20, 24, 25, 28, 29, 31, 38, 39, 41, 44, 46, 47, 48, 50, 51, 52, 59, 61, 62, 63, 64, 65, 67, 68, 71, 74, 80, 81, 82, 83, 84, 87, 88, 90], "exce": [47, 63], "except": [15, 17, 41, 67, 83], "exchang": [6, 90], "excit": [8, 20, 38, 39], "exclud": [13, 28, 63, 80], "exclude_dim": 80, "exclude_pattern": [20, 28], "exclus": 13, "exec": [37, 41, 84], "execcasp": [22, 43, 52, 87], "execut": [2, 14, 28, 41, 44, 45, 50, 56, 59, 69, 75, 84], "execute_notebook": [44, 50, 71], "exemplifi": [8, 10], "exercis": 38, "exhaust": 74, "exist": [0, 2, 7, 8, 10, 13, 14, 15, 29, 32, 37, 38, 48, 69, 80, 83, 84, 86, 87], "exist_ok": 86, "exit": [12, 45], "exp": 43, "exp_i": 36, "expand": [44, 80, 83, 87, 88], "expand_dim": [72, 83, 87], "expandus": 87, "expans": 87, "expect": [8, 17, 43, 45, 47, 51, 72, 73, 74, 80, 83, 87, 88, 90], "expens": [20, 43, 61, 73, 87], "experi": [4, 6, 8, 15, 16, 29, 36, 37, 38, 42, 43, 46, 50, 59, 62, 74, 82, 84, 87, 88, 90], "experiment": [10, 56, 67], "experiment_id": [37, 42], "expert": [8, 15, 62, 88, 90], "expertis": [2, 24, 29, 90], "explain": [7, 8, 12, 13, 15, 16, 81], "explan": [8, 15, 23], "explicit": [23, 25, 29, 87], "explicitli": [2, 14, 15, 84], "explor": [8, 23, 25, 29, 44, 46, 61, 63, 71, 73, 80, 83, 88], "exploratori": 44, "export": [23, 45, 46, 51], "express": [10, 15, 23, 28, 87], "ext": 48, "extend": [15, 30, 31, 71, 81, 84], "extens": [2, 15, 18, 20, 23, 28, 30, 31, 32, 38, 39, 41, 42, 46, 51, 57, 61, 65, 67, 68, 84, 92], "extenst": 65, "extern": [8, 59, 69, 82], "extra": [8, 12, 13, 52, 74, 80, 84], "extract": [2, 23, 39, 63, 68, 80, 86, 87, 90, 91], "extran": 15, "extrem": [10, 15, 63, 67, 90], "ey": [7, 74, 78, 80], "f": [1, 7, 8, 14, 17, 18, 19, 20, 21, 26, 27, 33, 34, 39, 41, 44, 47, 50, 55, 58, 61, 67, 71, 72, 80, 83, 84, 86, 88], "f02n07": 38, "f02n07important_not": 38, "f09_g16": [7, 38], "f09_g17": [84, 87], "f11": [72, 83, 84], "f11vmr": [72, 83, 84], "f12": [72, 83, 84], "f12vmr": [72, 83, 84], "f19_g1": 39, "f19_g17": [28, 39, 44], "f368": 61, "f4": 86, "f43c56e0": 86, "f59b0bfe": 84, "f59e9f61": 87, "f6f0": 37, "f6zb330g": 41, "f8": 86, "f90": [61, 80], "face": [8, 29, 36, 74, 88, 90], "facelift": [8, 10], "facil": [6, 8, 10], "facilit": [90, 92], "fact": [12, 15, 39, 88], "factor": [7, 29], "faculti": 63, "fahrenheit": 38, "fail": [7, 12, 14, 25, 42, 69, 80, 84], "fairli": [8, 50, 72, 88], "fake": [72, 80], "falko": [2, 91], "fall": [8, 10, 16, 77, 84], "fals": [11, 15, 18, 20, 37, 41, 42, 43, 45, 46, 47, 61, 67, 73, 80, 81, 84, 86], "famili": 23, "familiar": 35, "fan": 40, "fanast": 62, "fantast": 62, "faq": [8, 28, 29, 30, 37], "far": [8, 32, 59, 63, 68, 74], "fast": [25, 32, 84, 86], "faster": [20, 29, 53, 74, 80], "fastest": 29, "fatal": 12, "fault": 67, "favorit": 63, "featur": [8, 23, 38, 41, 63, 71, 74, 80, 81], "feature_artist": 80, "featureartist": 80, "feb": 41, "februari": [7, 8, 11, 16, 60, 61, 68, 78, 81], "fed": [20, 28, 41], "feder": 63, "feed": [63, 71], "feedback": [6, 17, 24, 77, 83, 90], "feel": [4, 6, 8, 12, 15, 23, 29, 35, 74, 75, 88], "fellow": 32, "felt": 11, "few": [6, 7, 8, 22, 23, 25, 28, 37, 39, 41, 43, 44, 51, 57, 59, 61, 62, 63, 65, 67, 71, 73, 80, 84, 86, 90], "fewer": [45, 80], "ff": 7, "ff91a4a71464": 61, "ffbb27b2e849e89719a8455875172787": 73, "fg": 80, "fg_co2": [20, 44], "field": [7, 8, 24, 32, 38, 39, 42, 43, 61, 63, 67, 83, 86], "field_target": 83, "fieldtyp": 67, "fifth": [8, 69], "fig": 37, "figsiz": [37, 47, 81], "figur": [8, 11, 28, 31, 36, 37, 46, 47, 48, 63, 65, 72, 80, 81], "figurenam": 48, "file": [0, 1, 8, 12, 13, 14, 15, 16, 19, 21, 26, 27, 29, 30, 31, 32, 37, 39, 40, 42, 43, 45, 46, 48, 52, 55, 56, 58, 61, 63, 65, 66, 69, 70, 78, 80, 82, 90, 92], "file_access": 20, "file_read_in": 20, "file_subset": 67, "filelist": 84, "filenam": [7, 12, 17, 20, 48, 50, 72, 83], "filename_1980": 17, "filename_1981": 17, "filename_1982": 17, "filepath": [18, 20, 28, 41], "fileserv": 61, "filesystem": [8, 12, 20, 39, 41, 61, 84], "filesystemload": 15, "fill": [6, 15, 16, 41, 63, 80, 81, 90], "fill_valu": [47, 80, 83, 86], "filter": 86, "filterwarn": [20, 43, 46], "final": [7, 8, 23, 46, 66, 76, 80], "find": [6, 8, 11, 15, 24, 25, 32, 34, 37, 57, 59, 67, 73, 79, 81, 82, 86, 87, 88, 89, 91], "fine": [14, 45, 90], "finer": [8, 23, 81], "finidat_interp_dest": 80, "finish": [8, 14, 20, 28, 50], "first": [0, 7, 8, 11, 12, 13, 14, 15, 16, 18, 19, 21, 23, 26, 27, 28, 31, 32, 33, 34, 35, 36, 38, 39, 40, 41, 43, 44, 49, 50, 54, 55, 58, 60, 61, 62, 63, 65, 66, 68, 70, 72, 73, 74, 76, 78, 80, 81, 82, 84, 86, 88, 90], "first_cas": 39, "first_plot": 39, "fish": 12, "fit": [7, 8, 20, 62, 73, 87], "fitzgerald": [2, 91], "five": [18, 24, 68], "fix": [0, 7, 17, 39, 45, 80, 86, 88], "fix_tim": 65, "flag": [7, 67], "flag_canfra": 67, "flag_clayfrac": 67, "flag_erod": 67, "flag_frc_urb2d": 67, "flag_imperv": 67, "flag_mean": 80, "flag_sandfrac": 67, "flagdescript": 67, "flagstagg": 67, "flask": [8, 15], "flat": [68, 80], "flatlin": 62, "flexibl": [7, 23, 24, 25, 51, 63, 86, 92], "flexibli": 23, "flip": [75, 76, 77], "flist": [84, 86], "fln": 36, "flnsc": 36, "float": [11, 13, 14, 15, 47, 48, 61, 73, 80, 87], "float32": [11, 23, 28, 38, 39, 41, 46, 51, 61, 65, 67, 68, 72, 80, 81, 83, 86, 87], "float320": [41, 61, 65, 80], "float321": [41, 65], "float3213": 65, "float32180": 81, "float3219": 81, "float322": 46, "float32260": 65, "float3227": 65, "float32372": 61, "float3239": 65, "float32500": [39, 61, 68], "float327": 65, "float32804": 65, "float3287": 46, "float32dask": [38, 39, 46, 61, 67, 68, 72, 80, 83, 86, 87], "float32nan": 46, "float64": [11, 17, 23, 28, 38, 39, 41, 46, 51, 61, 68, 72, 73, 80, 81, 83, 84, 86, 87], "float640": [38, 41, 46, 61, 72, 80, 83, 84, 86, 87], "float641": [73, 86], "float642": [46, 72, 83, 84, 86], "float64240": 72, "float64244": 83, "float643": [38, 41, 46, 72, 83, 84], "float64320": 39, "float64321": 39, "float64500": 61, "float64900": 72, "float64dask": [17, 46, 61, 72, 73, 80, 83, 84], "float64index": [72, 81, 83, 84, 86], "float64nan": [46, 61], "float64nanlong_nam": 46, "floor": 86, "flow": 67, "flowstagg": 67, "flu": 36, "fluctuat": 63, "flut": [36, 41], "flutc": 41, "flux": [36, 41, 86], "fluxtime_avg_info": 86, "fluxunit": 41, "fname": 84, "fo": [84, 86], "focu": [2, 18, 23, 25, 29, 42, 52], "focus": [2, 6, 8, 24, 25, 29, 32, 40, 44, 46, 63, 91, 92], "foddergrass": 80, "folder": [0, 12, 25, 86], "folk": 90, "follow": [3, 7, 8, 11, 12, 15, 16, 17, 19, 20, 21, 23, 24, 26, 27, 28, 29, 30, 31, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 44, 46, 47, 49, 50, 52, 54, 55, 56, 57, 58, 59, 61, 62, 63, 64, 65, 66, 67, 68, 70, 71, 73, 74, 75, 76, 78, 80, 82, 90, 91], "fontsiz": 37, "foothil": [8, 65], "forc": [8, 10, 14, 24, 37, 44, 72], "forcing_vari": [37, 41, 46], "forecast": [8, 30, 31, 67], "forehead": 15, "forg": [7, 23, 25, 28, 36, 44, 50, 52, 63, 71, 72, 83, 84, 86], "forget": 77, "fork": [0, 35], "form": [2, 8, 11, 15, 16, 29, 59, 63, 70, 77, 80, 85, 86, 87], "formal": [8, 15, 59, 86, 89], "format": [0, 6, 8, 11, 14, 17, 20, 24, 28, 29, 37, 41, 42, 44, 46, 48, 50, 59, 62, 65, 67, 77, 80, 83, 84, 86, 91], "format_exc": 41, "format_funct": 61, "formatcoodata": [80, 83], "fortun": [8, 15, 23, 25, 37, 50, 61, 64, 65], "forum": [7, 8, 76, 77, 91], "forward": [8, 12, 24, 29, 30, 32, 59, 67, 75, 77, 83, 85], "fosi": 20, "foster": [2, 8, 25, 88], "found": [7, 8, 12, 15, 20, 25, 28, 37, 41, 47, 50, 53, 57, 59, 62, 64, 76, 81, 83, 88], "foundat": [4, 15, 31, 63, 65], "four": [61, 62, 63, 90], "fourier": 46, "fourth": [8, 69], "fpar": 67, "fparstagg": 67, "fptr": 44, "fpzptb2f": 37, "frac_a": [72, 83], "frac_b": [72, 83], "fraction": [2, 63, 67, 80], "fractiondescript": 67, "fractionstagg": 67, "frame": [43, 63], "frame_width": 72, "framework": [24, 29, 30, 39, 71], "frc_urb2d": 67, "free": [4, 6, 15, 23, 29, 35, 57, 75, 90], "freedonia": 15, "freq": [46, 65, 72, 81, 83, 84, 86, 87], "freq_i": [36, 50], "frequenc": [8, 20, 28, 36, 37, 38, 39, 41, 42, 46, 61, 68, 81, 86], "frequent": 63, "fridai": [8, 63, 75, 77, 85, 88], "friend": [11, 74, 80], "friendli": [46, 62, 86], "fro": 63, "from": [0, 2, 4, 6, 7, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 25, 26, 27, 29, 30, 31, 32, 33, 34, 35, 36, 38, 40, 42, 43, 44, 45, 47, 48, 49, 51, 52, 53, 54, 55, 56, 57, 58, 59, 62, 63, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 78, 79, 80, 83, 85, 86, 87, 88, 89, 90, 91, 92], "from_arrai": [73, 80], "from_list": 61, "from_sequ": 86, "from_weights_fil": 72, "front": 13, "frontend": [8, 15, 61], "frontera": 72, "frozen": 7, "fruit": 90, "fs_s3": 84, "fsn": 36, "fsnsc": 36, "fsntoa": 41, "fsntoac": 41, "fsspec": [84, 86], "ftp": 65, "full": [25, 30, 46, 47, 48, 62, 63, 67, 86, 91], "full_lik": [47, 83], "fulli": [8, 10, 74], "fulljra": 61, "func": [38, 80], "function": [8, 10, 11, 12, 13, 14, 15, 16, 22, 28, 31, 33, 34, 40, 43, 44, 46, 47, 51, 53, 60, 67, 69, 71, 73, 74, 80, 82, 84, 86, 87, 92], "fund": [24, 63, 79], "fundament": [2, 16, 25, 42, 60], "fundrais": 63, "funnel": [30, 31, 32], "funni": 73, "funtion": 38, "further": [8, 20, 28, 29, 43, 47, 61, 67, 74], "futur": [6, 8, 10, 11, 20, 24, 29, 37, 46, 61, 63, 67, 74, 84, 87, 90], "future_cmip6": 46, "future_smbb": 46, "futurewarn": [61, 84, 87], "fv_0": [84, 87], "g": [0, 1, 6, 8, 10, 18, 20, 28, 45, 61, 71, 81, 86, 87, 90], "g1850eco_jra": 18, "g1850eco_jra_hr": 18, "gagn": 32, "gain": 29, "galleri": [8, 23, 24, 46], "game": [8, 35, 74], "gap": [63, 84], "garbag": [12, 14], "garcia": 61, "gatewai": [8, 37], "gather": [8, 24, 25, 29, 41, 59, 62, 80], "gauss": 46, "gb": [7, 8, 17, 20, 29, 31, 41, 43, 47, 61, 84, 87], "gc": [80, 81], "gcc": [72, 83, 84, 86], "gear": [8, 15, 71, 74], "gen_corner_calc": 61, "gen_json": 84, "gen_ref": 86, "gener": [4, 6, 8, 13, 14, 15, 20, 23, 24, 28, 37, 39, 41, 43, 44, 50, 52, 53, 57, 61, 62, 63, 67, 69, 72, 80, 81, 83, 87, 88, 90], "generate_cbar": 61, "generate_json": 86, "generatornorm": [72, 83], "geo": [38, 63, 72], "geocat": [7, 8, 19, 24, 29, 39, 41, 48, 60, 75, 77, 90, 91], "geocat_comp_tutori": 33, "geocollect": 80, "geograph": 23, "geolat": 86, "geolat_c": 86, "geolat_u": 86, "geolat_v": 86, "geolon": 86, "geolon_c": 86, "geolon_u": 86, "geolon_v": 86, "geoquadmesh": 80, "geoscienc": [2, 6, 8, 10, 25, 30, 59, 60, 62, 77, 82, 92], "geoscientif": [8, 10, 29], "geoscientist": [2, 8, 74, 82], "geoview": [8, 32, 41], "get": [0, 6, 7, 8, 12, 13, 15, 16, 25, 28, 29, 31, 38, 43, 47, 57, 61, 63, 64, 67, 68, 71, 74, 75, 76, 77, 79, 80, 81, 83, 86, 87, 88, 90], "get_bound": 7, "get_bounds_dim_nam": 7, "get_clean_interp_index": 73, "get_directori": 20, "get_filelist": 20, "get_mapp": [84, 86], "get_templ": 15, "getitem": [46, 68], "getlogg": 46, "gf": [23, 41], "gfevyho4": 41, "gh": 44, "ghp": 50, "ght": 67, "giant": 73, "gib": [37, 38, 41, 46, 61, 67, 68, 72, 73, 80, 83, 84, 86, 87], "gift": 15, "giphi": 74, "gist": 73, "git": [0, 7, 8, 12, 16, 19, 21, 26, 27, 28, 33, 34, 38, 40, 50, 55, 56, 58, 60, 66, 67, 70, 78, 85, 91], "git_discovery_across_filesystem": 12, "git_repo": [20, 28, 50], "github": [0, 1, 4, 8, 10, 12, 18, 19, 21, 23, 26, 27, 28, 29, 33, 34, 38, 40, 49, 55, 56, 57, 58, 59, 60, 63, 64, 66, 67, 70, 73, 78, 83, 87], "github_token": 44, "github_usernam": 50, "githubusercont": [18, 36, 38, 46, 50], "gitignor": [8, 50, 69], "give": [6, 7, 10, 25, 28, 45, 63, 73, 81, 88], "given": [7, 8, 14, 17, 18, 23, 39, 41, 42, 44, 47, 51, 61, 64, 65, 67, 68, 74], "gjnimb52": 41, "gjrav3": 86, "glacier": 80, "glacier_mec": 80, "glade": [6, 7, 8, 20, 22, 23, 28, 37, 38, 39, 41, 42, 43, 44, 47, 50, 52, 61, 67, 68, 71, 72, 80, 83, 84, 86, 87, 90], "glc": 28, "glcnecctype_deep_lak": 80, "glob": [28, 41, 43, 44, 67, 84, 86, 87], "global": [8, 12, 14, 23, 36, 38, 40, 41, 46, 47, 61, 63, 80, 92], "global_ocean": 36, "globalintake_esm_attr": 38, "gmom": 86, "gmted2010": 67, "gn": 42, "gngr7asx": 41, "gnomon": 72, "go": [8, 10, 12, 15, 20, 25, 28, 29, 32, 37, 39, 41, 42, 44, 59, 63, 73, 77, 80, 86, 90], "goal": [8, 10, 16, 18, 24, 29, 32, 35, 59, 63, 74, 77, 84, 85, 88, 90, 91], "goe": 40, "gomipecoiaf_jra": 20, "good": [7, 8, 10, 12, 15, 16, 24, 28, 31, 36, 43, 45, 48, 53, 62, 63, 64, 71, 73, 74, 79, 82, 86, 87, 90], "googl": [6, 8, 15, 16, 19, 21, 24, 26, 27, 29, 33, 34, 35, 40, 49, 54, 55, 56, 57, 58, 60, 66, 70, 74, 75, 76, 77, 78, 82, 84, 88], "gordon": 63, "got": [15, 83, 90], "gouraud": 68, "gov": [46, 61], "govcreator_typ": 61, "govcreator_url": 61, "govern": [2, 24, 63], "govnodc_template_vers": 61, "gpcp_jja_climo": 41, "gpp": 80, "gpu": 80, "gracefulli": 45, "gradient": 38, "graduat": [2, 40], "gram": [36, 39], "grant": [29, 63], "grape": 80, "graph": [36, 43, 50, 62, 72, 73, 83, 84, 86, 87, 88], "graph_attr": [36, 50], "graphic": [23, 62], "graphviz": [8, 50], "grasp": [8, 74], "grassroot": 25, "graze_sp_zootot": 28, "great": [4, 6, 7, 8, 23, 25, 29, 42, 48, 51, 59, 64, 81, 84, 86, 87, 90], "greater": [8, 10, 15, 63, 88], "greatest": [10, 20], "green": [21, 50, 58, 65, 66], "greenfrac": 67, "greenland": [8, 23], "greet": 15, "gregorian": 11, "grew": 25, "grib2": 86, "grid": [8, 17, 24, 25, 32, 36, 38, 39, 41, 47, 63, 67, 72, 80, 84, 85, 86, 87, 91, 92], "grid1d_ixi": 80, "grid1d_jxi": 80, "grid1d_lat": 80, "grid1d_lon": 80, "grid_file_dst": [72, 83], "grid_file_src": [72, 83], "grid_loc": 68, "grid_map": 61, "grid_mapping_nam": 61, "grid_subset": 46, "grid_til": 86, "grid_typ": 86, "gridcel": 80, "gridlin": 81, "gridmap": 61, "gridpublisher_nam": 61, "gridstagg": 67, "gross": 80, "ground": 67, "groundnut": 80, "group": [4, 8, 10, 11, 17, 19, 21, 26, 27, 29, 32, 33, 34, 35, 40, 42, 49, 54, 55, 56, 58, 59, 60, 63, 66, 67, 70, 75, 77, 78, 81, 82, 85, 88, 90, 91], "groupbi": [11, 20, 25, 28, 37, 38, 41, 46, 67, 68, 80, 81], "groupby_attr": [20, 28, 41], "groupcreator_institut": 61, "grover": [2, 8, 31, 32, 40, 58], "grow": [11, 25, 29], "grumpi": 74, "gt": [17, 23, 38, 39, 41, 46, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "gtopo30_0": 38, "gtopo30_ne12": 83, "gtopo30_ne120np4_16xdel2": [23, 72, 83], "guess": 11, "guid": [4, 7, 8, 24, 28, 42, 48, 59, 74, 90], "guidanc": 24, "guidelin": [3, 12], "gv": [23, 81], "gw": [41, 46, 84], "gz": [20, 28, 41], "h": [15, 20, 23, 28, 39, 43, 61, 80], "h0": [7, 28, 41, 80], "h1": [37, 80, 87], "h2": 72, "h2o": 41, "h4": 83, "h5chunk": 84, "h5netcdf": 84, "h6": 84, "h_taqxfo": 37, "ha": [2, 6, 7, 8, 12, 13, 14, 15, 16, 17, 22, 25, 28, 29, 30, 31, 32, 37, 38, 39, 41, 45, 47, 48, 51, 59, 61, 62, 63, 65, 67, 68, 71, 72, 73, 74, 78, 80, 81, 82, 83, 84, 86, 87], "hack": 63, "hackathon": [77, 85], "hacki": 74, "had": [8, 11, 12, 14, 15, 30, 32, 62, 63, 79, 89, 90], "hadcrut4": 46, "hadcrut4refer": 46, "hadcrut4var_desc": 46, "hadisst_cl_03_climo": 41, "hadisst_pd_02_climo": 41, "hadisst_pi_05_climo": 41, "hadlei": 46, "hadob": 46, "haii": 25, "hailei": 89, "half": 73, "hall": [8, 32, 64], "hamman": [8, 46], "hand": [12, 15, 90], "handi": [51, 87], "handl": [52, 65, 73, 80], "hang": 17, "hannai": [41, 44], "hannayamwg_creation_d": 41, "happen": [8, 10, 11, 14, 28, 29, 45, 47, 69, 74, 76, 83, 90, 91], "happi": [23, 74], "hard": [7, 8, 11, 14, 15, 65, 67, 71, 74, 81, 87, 90], "hardcod": 72, "harri": 63, "has_year_zero": [38, 41, 46, 61, 68, 72, 80, 83, 84, 86, 87], "hasn": 73, "hat": 74, "hauser": 2, "have": [0, 1, 6, 8, 10, 11, 12, 14, 15, 16, 17, 18, 19, 20, 23, 24, 25, 26, 27, 28, 29, 30, 32, 35, 37, 38, 39, 41, 42, 43, 44, 45, 46, 49, 50, 51, 52, 54, 57, 61, 62, 63, 64, 65, 66, 67, 68, 69, 71, 72, 73, 74, 75, 77, 79, 80, 81, 82, 83, 84, 86, 87, 88, 89, 90], "haven": [50, 52], "hawaiian": 40, "hdf": [29, 84], "hdf5": [29, 62, 84, 86], "he": [8, 23, 40, 70, 78], "head": [15, 43, 56, 59], "headach": [8, 11, 73, 74, 81], "header": [12, 13, 44, 59, 63], "hear": 90, "heat": [36, 63], "heather": [2, 32, 76, 77], "heavi": [8, 47, 71], "height": [18, 23, 37, 39, 46, 61, 63, 67, 72, 81], "heightstagg": 67, "heighttime_avg_info": 86, "held": [15, 31, 63], "hello": 8, "help": [2, 6, 8, 10, 11, 16, 17, 20, 24, 25, 28, 29, 30, 32, 36, 37, 39, 41, 43, 46, 47, 50, 51, 57, 59, 61, 62, 65, 67, 68, 70, 71, 74, 76, 79, 80, 82, 84, 87, 88, 90, 91], "helpdesk": 7, "helper": [14, 46, 84, 86, 90], "henderson": 89, "her": [8, 19, 82], "herd": 29, "here": [1, 6, 7, 8, 10, 11, 12, 13, 14, 15, 18, 20, 22, 23, 24, 25, 32, 33, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 50, 51, 52, 53, 54, 57, 64, 65, 67, 68, 69, 72, 73, 74, 76, 77, 80, 81, 83, 84, 86, 87, 88, 91], "heroku": 18, "heurist": [53, 86], "hgroup": 86, "hgt_m": 67, "hi": [20, 28, 40, 78], "hidden": [12, 45, 80, 86], "hide": [17, 44, 88], "hierarch": 25, "hierarchi": 86, "high": [6, 7, 8, 23, 24, 32, 39, 51, 72], "higher": [8, 23, 43, 68, 80, 83, 86], "highli": 6, "highlight": [8, 24, 33, 34], "highr": [8, 18], "hike": 40, "him": 40, "hire": [8, 28, 32, 37, 61], "hires1": 72, "hires_pop_obs_comparison": 61, "hist": [20, 28, 36, 44, 50], "hist_interv": 80, "histfilemod": 80, "histogram": 18, "histor": [8, 37, 46, 83, 84], "histori": [7, 8, 17, 23, 32, 35, 39, 41, 44, 46, 61, 62, 63, 80, 87], "historical_cmip6": 46, "historical_smbb": 46, "history_catalog": 20, "hit": [15, 71], "hksat": 80, "hmm": 73, "hmw": 12, "hmxl": 44, "hmxl_dr_2": 20, "hoc": [28, 63], "hold": [2, 6, 8, 12, 15, 24, 32, 39, 53, 74, 80, 87], "hole": 63, "holidai": 16, "holoview": [8, 20, 38, 41, 46, 61, 65, 67, 68, 83, 84], "holoviz": 18, "home": [6, 12, 23, 28, 37, 43, 51, 57, 84, 87], "homepag": [23, 51, 87], "homm": 83, "hone": 74, "hood": [37, 43, 83], "hook": 0, "hope": [8, 11, 36, 37, 43, 50, 57, 67], "hopefulli": [8, 12, 15, 47, 74, 80, 90], "horizon": 15, "horizont": [39, 61, 80, 81], "host": [1, 8, 11, 16, 19, 21, 26, 27, 33, 34, 38, 40, 46, 49, 51, 55, 56, 57, 58, 64, 66, 68, 70, 72, 75, 76, 77, 78, 83, 84, 85, 87, 88, 90, 91], "hostnam": 80, "hour": [7, 8, 16, 23, 62, 63, 74, 81, 90, 91], "hour_6i": 72, "hourli": [8, 67, 81, 83], "hous": 6, "hover": [39, 46], "how": [2, 6, 8, 10, 11, 12, 13, 14, 15, 16, 20, 22, 23, 28, 30, 31, 32, 35, 37, 41, 42, 43, 45, 46, 48, 50, 51, 53, 59, 60, 61, 62, 63, 65, 67, 68, 69, 72, 73, 74, 76, 77, 80, 81, 86, 87, 88], "howev": [8, 10, 14, 15, 20, 66, 71, 73, 80, 81], "hoyer": 17, "hpa": 67, "hpaarrai": 84, "hpabound": 72, "hpalong_nam": 41, "hpaposit": [41, 72, 83, 84], "hpc": [6, 8, 22, 31, 37, 38, 41, 43, 46, 52, 61, 62, 67, 68, 83, 84, 86, 87, 88, 90, 91], "hr": 72, "href": 18, "htmcalendar": 68, "htmhistori": 39, "htmintake_esm_varnam": 61, "html": [1, 8, 15, 20, 44, 50], "htmldods_extra": 46, "http": [1, 8, 12, 17, 18, 19, 22, 23, 26, 27, 28, 34, 35, 36, 37, 38, 39, 40, 41, 43, 46, 50, 51, 52, 55, 56, 61, 62, 63, 64, 67, 68, 70, 73, 78, 80, 83, 84, 86, 87], "hub": [6, 44], "huge": [8, 59, 63], "human": 65, "humanitarian": 15, "humbl": 25, "humid": 67, "humiditystagg": 67, "humor": 74, "hv": [20, 23, 28, 38, 39, 41, 46, 61, 65, 67, 68, 84], "hv_logo": 18, "hvd": 39, "hvplot": [8, 20, 31, 32, 38, 41, 44, 46, 65, 68, 72, 84], "hyai": [46, 72, 83, 84], "hyam": [38, 41, 46, 72, 83, 84], "hybi": [46, 72, 83, 84], "hybm": [38, 41, 46, 72, 83, 84], "hybrid": [8, 38, 41, 46, 72, 75, 77, 83, 84, 85, 90, 91], "hypothesi": 20, "i": [2, 4, 6, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 54, 55, 56, 57, 58, 59, 60, 62, 63, 65, 66, 68, 69, 70, 72, 75, 77, 78, 79, 81, 82, 83, 84, 85, 87, 88, 90, 92], "iag": 67, "ib": [8, 37], "ib0": [22, 43, 52, 87], "ic": [20, 28, 67, 87], "icon": [0, 21, 57, 58, 66, 71], "id": [22, 23, 28, 37, 38, 39, 43, 51, 52, 61, 63, 68, 72, 80, 83, 87], "idea": [0, 6, 8, 10, 25, 28, 31, 63, 74, 80, 86, 90], "ideal": [8, 18, 20, 46, 62, 79], "ident": [12, 17, 50, 74, 80, 83], "identifi": [2, 63, 64, 72, 86], "idl": [63, 87], "idntifi": 86, "ifrac": 44, "igbp": 67, "ignor": [15, 20, 43, 46, 84], "ignore_index": 20, "ihesp": 72, "ilev": [46, 72, 83, 84], "ilevpandasindexpandasindex": [72, 83, 84], "illinoi": 40, "illumin": [2, 8, 15], "illustr": [17, 43, 73, 83], "imag": [8, 18, 23, 39, 44, 48, 50, 72, 73, 80, 88], "imageri": [25, 40], "imagin": [15, 38], "img": [18, 64], "immedi": [47, 74, 75], "impact": [2, 63, 68], "imperv": 67, "impervi": 67, "implement": [6, 8, 10, 38, 39, 47, 68, 73, 74, 81, 87, 92], "impli": 73, "implic": [8, 22], "import": [7, 8, 15, 18, 22, 25, 29, 31, 32, 42, 44, 45, 51, 52, 59, 62, 63, 69, 71, 72, 73, 74, 86, 87, 88], "important_not": 38, "impost": [8, 74], "impress": 20, "improv": [2, 7, 8, 10, 25, 39, 59, 60, 62, 73, 84, 90], "in_shap": [72, 83], "inaccur": 81, "inc": 15, "inch": [48, 81], "includ": [2, 4, 6, 7, 8, 11, 18, 20, 22, 23, 24, 25, 28, 29, 32, 36, 37, 38, 39, 41, 42, 43, 44, 45, 46, 50, 51, 57, 59, 61, 62, 63, 67, 68, 69, 71, 77, 80, 83, 86, 90, 91, 92], "includi": [8, 72], "inclus": [2, 13, 25, 63, 91], "incom": 41, "incopor": 63, "incorrect": 68, "incorrect_plot": 68, "increas": [2, 8, 23, 29, 37, 43, 47, 72], "incud": 39, "inde": 86, "indent": 13, "independ": [80, 86], "index": [1, 7, 8, 11, 13, 15, 16, 25, 32, 46, 50, 56, 67, 69, 72, 80, 81, 83, 84, 86, 87], "indic": [36, 57, 67, 83], "indirectli": 63, "individu": [6, 8, 39, 42, 43, 62, 76, 77, 79, 86, 87, 91], "industri": 63, "ineffici": 62, "inevit": 25, "infer": [14, 48], "inferno": [67, 81], "infil": 84, "infiltr": 17, "influenc": 61, "influenti": 63, "info": [25, 28, 37, 38, 41, 46, 61, 67, 68, 73, 80, 83, 84, 86, 87], "info_list": 41, "infor": 61, "inform": [0, 2, 4, 6, 8, 11, 13, 15, 16, 19, 21, 22, 24, 26, 27, 28, 29, 33, 34, 35, 38, 39, 41, 49, 50, 54, 55, 56, 57, 58, 59, 60, 61, 65, 66, 67, 70, 71, 72, 75, 78, 80, 81, 82, 83, 86, 90], "informat": [8, 10], "informationcom": 80, "informationproject": 61, "informationpublisher_typ": 61, "infrar": 63, "infrastructur": [25, 59, 63], "ingest": 90, "inherit": 88, "inic": 83, "init": [11, 12, 35], "initi": [1, 2, 3, 6, 7, 12, 13, 17, 25, 29, 36, 38, 40, 77, 87, 92], "initial_condit": 20, "initial_fil": [23, 38, 51, 72, 83, 84], "inject": 44, "inlin": [43, 46, 50, 80], "inline_threshold": [84, 86], "innov": [2, 63], "inport": 52, "input": [7, 8, 14, 15, 22, 23, 29, 43, 44, 48, 50, 51, 52, 53, 59, 71, 72, 73, 80, 83, 87], "input_core_dim": 80, "inputdata": [23, 38, 51, 61, 72, 80, 83, 90], "inquiri": 29, "insert": [15, 72, 83], "insid": [12, 15, 25], "insight": [24, 25, 41, 74], "inspect": [42, 67, 71], "inspector": 71, "inspir": [2, 8, 10, 17, 92], "instal": [1, 7, 8, 12, 15, 19, 21, 23, 24, 26, 27, 28, 35, 36, 40, 44, 45, 49, 52, 54, 55, 56, 57, 58, 61, 66, 69, 70, 71, 78, 82], "installt": 7, "instanc": [7, 12, 84], "instant": 80, "instantan": 17, "instanti": 38, "instantli": 23, "instead": [7, 8, 10, 11, 12, 14, 15, 25, 36, 38, 43, 44, 45, 50, 52, 53, 62, 68, 73, 84, 87], "institut": [8, 10, 41, 61], "institutionpublisher_url": 61, "instruct": [7, 8, 19, 21, 26, 27, 40, 48, 49, 50, 54, 55, 56, 58, 59, 62, 64, 66, 70, 73, 75, 77, 78], "instructor": 62, "instructuion": 82, "instrument": 63, "int": [28, 37, 41, 73, 80, 83], "int32": [41, 46, 61, 65, 72, 83], "int320arrai": 65, "int320long_nam": 46, "int321": 72, "int321480550400arrai": 65, "int321543505128": 46, "int321arrai": 41, "int32300arrai": 65, "int32dask": [46, 72, 83], "int64": [38, 61, 68, 72, 73, 80], "int640": [73, 80], "int641": [38, 61, 73, 80], "int641arrai": 61, "int642015": 68, "int64index": 72, "intak": [8, 25, 31, 32, 44, 61, 82, 86], "intake_esm": 38, "intake_esm_attr": 38, "intake_esm_dataset_kei": [28, 38, 39, 46, 61], "intake_esm_varnam": [28, 39, 46, 61], "intarrai": 17, "integ": [14, 36, 53, 67, 80], "integr": [2, 8, 10, 25, 39, 64, 72], "intend": [71, 74], "intens": [2, 63], "interact": [2, 8, 23, 24, 35, 39, 41, 46, 57, 59, 62, 63, 67, 85, 90, 91], "interactive_plot_templ": 44, "interactiveshel": [37, 41], "intercomparison": 42, "interest": [2, 7, 8, 18, 20, 23, 24, 28, 29, 31, 32, 37, 39, 41, 42, 43, 44, 46, 51, 59, 62, 63, 64, 65, 68, 74, 80, 81, 85, 88, 90], "interfac": [8, 22, 25, 36, 43, 44, 46, 52, 59, 62, 72, 83, 84, 87], "interfaceposit": 86, "interlink": 2, "intermedi": [8, 23, 70, 84], "intern": [8, 72, 86], "internship": 40, "interp": 61, "interp1d": 47, "interp_method": 86, "interp_mld_dsigma": 47, "interpol": [8, 32, 63, 81, 83, 90], "interpret": [63, 86, 87], "interv": [6, 23, 38, 39, 61, 65, 68, 72, 80, 83, 84], "intrins": 2, "intro": [44, 75, 77], "introduc": [8, 16, 30, 70, 82], "introduct": [8, 21, 26, 27, 29, 35, 49, 51, 54, 55, 58, 60, 66, 82], "introductori": 91, "invalid": 28, "invalid_asset": [20, 28, 41], "invalid_assets_amwg_obs_dataset": 41, "invalid_assets_cesm": [20, 28], "invar_flat": 83, "invari": [28, 86, 87], "invers": 41, "invest": 24, "investig": [8, 20, 36, 37, 42, 44, 47], "invidu": 63, "invit": [6, 88], "invok": 71, "involv": [6, 38, 59, 76, 86, 87], "io": [1, 50, 63, 64, 67], "iowa": 63, "ipnyb": 44, "ipykernel": [7, 71], "ipykernel_140729": 41, "ipykernel_197849": 20, "ipykernel_20245": 80, "ipykernel_launch": 28, "ipynb": [0, 8, 40, 44, 49, 50, 56, 59, 71, 80], "ipython": [20, 37, 41, 63, 72, 73, 80], "irradi": 63, "irradianceunit": [72, 83, 84], "irregular": [25, 51], "irrig": 67, "irrigated_barlei": 80, "irrigated_cassava": 80, "irrigated_citru": 80, "irrigated_cocoa": 80, "irrigated_coffe": 80, "irrigated_cotton": 80, "irrigated_datepalm": 80, "irrigated_foddergrass": 80, "irrigated_grap": 80, "irrigated_groundnut": 80, "irrigated_millet": 80, "irrigated_miscanthu": 80, "irrigated_oilpalm": 80, "irrigated_potato": 80, "irrigated_puls": 80, "irrigated_rapese": 80, "irrigated_ric": 80, "irrigated_ry": 80, "irrigated_sorghum": 80, "irrigated_spring_wheat": 80, "irrigated_sugarbeet": 80, "irrigated_sugarcan": 80, "irrigated_sunflow": 80, "irrigated_switchgrass": 80, "irrigated_temperate_corn": 80, "irrigated_temperate_soybean": 80, "irrigated_tropical_corn": 80, "irrigated_tropical_soybean": 80, "irrigated_winter_barlei": 80, "irrigated_winter_ry": 80, "irrigated_winter_wheat": 80, "is_lett": 15, "isccp": 72, "isccp_12_climo": 41, "isccpcosp_07_climo": 41, "isccpfd_07_climo": 41, "isel": [7, 23, 28, 38, 39, 41, 43, 47, 61, 67, 68, 72, 80, 81, 83, 84], "isel_dict": 18, "isinst": [72, 83], "isn": [8, 28, 45, 46, 67, 69, 74, 84], "isnan": 47, "isnul": [46, 47, 68], "iso": 61, "isol": 73, "issu": [6, 7, 8, 11, 12, 13, 17, 25, 28, 29, 39, 42, 43, 45, 48, 51, 53, 62, 65, 67, 73, 83, 90], "item": [6, 13, 15, 17, 20, 41, 43, 72, 80, 83, 86, 87], "iter": [2, 8, 13, 14, 41], "itertool": 17, "itim": 80, "its": [2, 14, 17, 28, 50, 59, 69, 74, 77, 80, 81], "itself": [8, 10, 15, 29, 38, 64, 74], "iv": [72, 83, 84, 86], "ivt": 72, "ixi": 80, "j": [1, 61], "j2": 15, "jain": 91, "jam": 91, "jan": [41, 46, 84], "jane": 15, "januari": [7, 8, 10, 16, 61, 80, 81, 85, 91], "jaroszynski": [76, 77, 91], "java": 63, "jb": 44, "jbuseck": 4, "jessica": 89, "jet": 83, "jgr": 17, "jhamman": 17, "jja": [41, 81], "jkent": [75, 88], "job": [7, 8, 11, 28, 31, 40, 41, 43, 44, 47, 52, 63, 87], "job_extra": 84, "job_extra_direct": 84, "job_script_prologu": 84, "joblib": 28, "jobqueu": [8, 20, 22, 25, 30, 31, 32, 43, 62], "joe": [8, 15, 46], "john": [2, 32, 91], "johnson": 89, "join": [6, 8, 10, 19, 21, 26, 27, 33, 34, 35, 40, 49, 54, 55, 56, 58, 66, 70, 78, 82], "join_exist": [20, 28], "join_new": 41, "jone": 89, "joss": 63, "jour": 29, "journal": 63, "journei": [8, 11, 62], "jpg": [48, 50], "jra25_son_climo": 41, "json": [20, 28, 36, 37, 38, 39, 41, 42, 43, 44, 46, 50, 61, 72, 83, 84, 86], "json_dir": 84, "judt": [2, 91], "jul": 41, "juli": [8, 26, 27, 82], "julia": [2, 10, 29, 32, 63, 75, 76, 77, 82, 88, 91], "juliu": [4, 25, 32], "jump": [20, 41], "june": [8, 28, 37, 66, 82], "jupyt": [4, 6, 7, 8, 12, 19, 21, 25, 26, 27, 31, 32, 33, 34, 40, 46, 49, 50, 53, 54, 55, 56, 59, 60, 63, 66, 70, 75, 78, 82, 83, 91], "jupyter_tutori": [49, 54], "jupyterbook": [8, 32, 39, 44, 59], "jupyterhub": [6, 8, 22, 25, 37, 38, 41, 43, 46, 50, 52, 57, 61, 62, 67, 68, 83, 84, 85, 86, 87], "jupyterlab": [0, 6, 8, 19, 26, 27, 33, 34, 36, 40, 45, 49, 54, 56, 62, 66, 70, 71, 78, 86, 87], "just": [7, 8, 10, 12, 13, 14, 21, 22, 29, 35, 37, 38, 41, 43, 45, 46, 50, 58, 61, 63, 64, 66, 67, 68, 69, 73, 74, 79, 83, 84, 86, 87, 88, 90], "justifi": 14, "jxy": 80, "k": [23, 41, 46, 47, 61, 71, 72, 80, 81, 83, 84, 86], "kai": [8, 31], "karrai": 46, "katelyn": [2, 91], "kati": [2, 76, 77], "kb": 17, "kdagon": 83, "kdescript": 67, "kdtree_sel": 51, "keep": [7, 8, 20, 25, 29, 38, 39, 61, 62, 68, 74, 78], "keep_attr": [39, 80], "keep_var": 43, "kei": [15, 17, 18, 20, 25, 28, 29, 32, 37, 38, 39, 41, 42, 43, 46, 47, 61, 63, 67, 86, 90], "kelvin": 38, "kelvindescript": 67, "kent": [2, 10, 32, 75, 76, 77, 82, 88, 91], "kerchunk": 8, "kernel": [7, 45, 63, 71], "kernel_nam": [44, 71], "kevin": [2, 8, 31, 35, 56, 89], "keynot": 25, "keyward": 15, "keyword": [11, 48, 74, 83], "kg": [67, 72, 86], "kib": [38, 46, 67, 68, 72, 73, 80, 83, 84, 86, 87], "kibi9ldk": 41, "kick": 91, "kickoff": [8, 32], "kill": [8, 25, 43], "killer": 25, "kilogram": 36, "kilogramgrid_loc": 39, "kind": [15, 81, 88, 90], "king": [2, 91], "klong_nam": [23, 41, 83, 84], "km": 80, "kmpaul": 56, "kmt": 43, "know": [7, 12, 14, 16, 31, 36, 53, 65, 68, 69, 74, 79, 80, 83, 87, 88], "knowledg": 2, "known": [7, 59, 78], "ko": [8, 12], "kootz": [8, 33, 34, 54, 55, 76, 77], "kpp": 86, "kpptime_avg_info": 86, "krill": [8, 43], "kristen": [8, 43], "kristenk": 43, "krumhardt": [8, 43], "kubeclust": 62, "kumar": 25, "kwarg": [42, 47, 68, 80, 86, 87], "kxarrai": 46, "l": [15, 71], "l9t684r1": 41, "lab": [2, 4, 6, 8, 10, 19, 26, 27, 29, 30, 33, 34, 40, 44, 45, 55, 56, 64, 66, 67, 70, 75, 77, 78, 85, 88, 90, 91], "label": [8, 15, 20, 23, 36, 37, 46, 47, 50, 63, 65, 68, 70, 73, 81], "labels": 81, "labor": 63, "laboratori": 10, "laboratorycontributor_rol": 61, "laboratorycreator_email": 61, "lack": 67, "lai": 67, "lai12m": 67, "laistagg": 67, "lake": [40, 80], "lake_depth": 67, "land": [8, 28, 59, 67, 81, 86], "land1d_act": 80, "land1d_gi": 80, "land1d_ityplunit": 80, "land1d_ixi": 80, "land1d_jxi": 80, "land1d_lat": 80, "land1d_lon": 80, "land1d_wtgcel": 80, "landfrac": 80, "landmask": [67, 80], "landsea": 67, "landunit": 80, "landunitflag_valu": 80, "landus": 67, "landusef": 67, "landusestagg": 67, "langlei": 41, "languag": [8, 10, 14, 16, 29, 63, 82], "larg": [2, 7, 8, 17, 23, 24, 25, 31, 36, 37, 38, 41, 42, 43, 62, 63, 67, 68, 73, 81, 84, 86, 87], "larger": [28, 51, 63, 68], "largest": 62, "last": [8, 11, 15, 17, 28, 29, 32, 38, 41, 42, 52, 54, 59, 61, 63, 67, 72, 80, 84, 88, 90], "lat": [8, 23, 25, 37, 38, 41, 46, 51, 61, 65, 72, 73, 80, 81, 83, 84, 87], "lat2d": 83, "lat_b": 61, "lat_bnd": [46, 61], "lat_bndsarrai": 61, "lat_bndslong_nam": 38, "lat_corn": 61, "lat_shap": 61, "latb": 83, "late": 11, "later": [6, 7, 12, 13, 28, 57, 61, 63, 68, 74, 83, 86, 87], "latest": [8, 44, 66, 80], "latitud": [17, 23, 41, 46, 51, 61, 67, 72, 73, 80, 81, 83, 84, 86], "latitude_chunks": 46, "latitude_longitudeepsg_cod": 61, "latitudeactual_rang": 81, "latitudearrai": 41, "latitudeaxi": 81, "latitudedescript": 67, "latitudelong_nam": [61, 87], "latitudestandard_nam": [38, 41], "latitudesunit": [39, 61], "latitudeunit": [23, 38, 41, 46, 61, 72, 80, 83, 84, 86, 87], "latpandasindexpandasindex": [72, 81, 83, 84, 87], "latter": 72, "launch": [8, 19, 26, 27, 33, 34, 40, 44, 45, 55, 56, 57, 66, 70, 75, 78, 86, 87], "lauritzen": 72, "law": 15, "layer": [8, 25, 46, 63, 67, 72, 80, 83, 84, 86, 87], "layerposit": [61, 68], "layerstagg": 67, "layertime_avg_info": 86, "layerunit": [39, 61], "layout": [35, 39, 65, 68], "lazi": [25, 67, 84], "lazili": [38, 68, 84], "lcpo": 2, "ldeo": 32, "le": [7, 8, 24, 31, 32, 38, 46, 84, 87], "le2": [84, 87], "lead": [2, 6, 8, 11, 17, 31, 62, 63, 73, 79, 84, 92], "leader": [75, 77], "leadership": [6, 63], "leak": 14, "leap": [11, 16], "learn": [2, 4, 8, 12, 15, 16, 29, 32, 37, 60, 62, 63, 65, 68, 75, 78, 82, 88], "learnpython": [19, 21, 26, 27, 33, 34, 35, 40, 49, 54, 55, 56, 58, 60, 66, 70, 78, 82], "least": [15, 61, 90], "leav": [15, 18, 50], "led": [8, 19, 21, 26, 27, 32, 33, 34, 35, 40, 43, 49, 54, 55, 56, 58, 63, 66, 70, 78], "left": [12, 36, 48, 50, 57, 59, 65, 81, 88], "lefthand": [50, 57], "lefttitl": 81, "lefttitlefonts": 81, "legaci": 10, "legates_04_climo": 41, "legend": [37, 46, 47, 65, 73], "legend_posit": 65, "lego": 25, "len": [8, 11, 17, 18, 23, 29, 36, 37, 38, 41, 46, 47, 61, 68, 72, 80, 83, 84, 86, 87], "length": [8, 11, 14, 46, 53, 61, 65, 67, 68, 72, 81, 83, 84, 86, 87], "lens2": [8, 37, 46], "less": [7, 10, 15, 25, 45, 47, 68, 74, 88], "lesser": 17, "lesson": [8, 25, 56, 62, 70, 78, 82], "let": [7, 10, 11, 14, 15, 16, 17, 20, 23, 25, 28, 35, 36, 37, 38, 39, 41, 42, 46, 47, 61, 67, 68, 79, 80, 83, 84, 87], "letter_bodi": 15, "lev": [2, 7, 38, 41, 46, 61, 72, 83, 84], "levdcmp": 80, "level": [2, 8, 37, 38, 39, 40, 41, 46, 48, 51, 56, 59, 70, 72, 78, 80, 81, 83, 84, 86], "level_desc": 81, "levelarrai": [38, 46], "levelsunit": 80, "leverag": [8, 24, 29, 61], "levgrnd": 80, "levi": [2, 10, 32, 91], "levlak": 80, "levpandasindexpandasindex": [72, 83, 84], "lh": 73, "liang": 17, "lib": [28, 37, 38, 41, 61, 67, 68, 80, 84, 87], "librari": [4, 7, 23, 29, 39, 47, 50, 53, 64, 68, 71, 84, 86], "licens": [50, 61], "lidar": [63, 72], "lift": [8, 71], "lightblu": 65, "lighten": 65, "lighter": 62, "lightgrai": 61, "lightgrei": 46, "lightweight": 45, "like": [0, 6, 7, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 21, 22, 25, 26, 27, 28, 33, 34, 35, 36, 38, 42, 43, 44, 45, 47, 49, 50, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 66, 67, 69, 70, 71, 72, 73, 74, 76, 78, 79, 80, 81, 82, 83, 84, 86, 88, 92], "limit": [2, 8, 25, 29, 37, 39, 50, 63, 73, 88], "linalg": 73, "line": [8, 12, 13, 15, 23, 39, 45, 46, 47, 50, 52, 61, 65, 73, 74, 81, 86], "line_width": 46, "linear": [8, 47, 73], "linearli": 47, "linearsegmentedcolormap": 61, "linewidth": 47, "link": [3, 6, 8, 19, 21, 22, 26, 27, 32, 33, 34, 35, 40, 43, 44, 46, 49, 52, 54, 55, 56, 57, 58, 59, 60, 62, 63, 64, 65, 66, 70, 75, 76, 78, 82, 86, 89], "linspac": [53, 61, 81], "liq": 87, "list": [7, 8, 13, 15, 17, 20, 28, 29, 32, 37, 39, 41, 42, 43, 44, 45, 49, 51, 53, 55, 61, 62, 69, 74, 80, 83, 86, 91, 92], "listen": [6, 74, 90], "liter": 15, "literaci": 2, "literal_ev": [20, 28, 39, 41, 61], "literatur": [8, 64], "littl": [35, 73, 86, 87, 90], "live": [8, 21, 49, 53, 54, 55, 57, 63, 65, 79, 90], "ll": [15, 28, 38, 41, 44, 46, 61, 65, 68, 72, 73, 79, 80, 81, 83, 84, 86, 87, 88], "lmd": 86, "lnd": [17, 28, 80, 86], "load": [7, 25, 30, 41, 43, 61, 63, 65, 67, 71, 72, 80, 83, 84, 86, 87, 92], "load_ext": [72, 83, 84, 86], "loader": 15, "loc": [18, 20, 36, 47, 50], "local": [0, 19, 21, 22, 26, 27, 37, 40, 41, 43, 50, 52, 55, 56, 58, 59, 63, 70, 72, 73, 78, 86], "local_directori": [22, 43, 52, 87], "local_scratch": 87, "localclust": [73, 86], "localhost": 1, "locarnini": 61, "locat": [8, 14, 20, 28, 41, 47, 65, 72, 75, 80, 85, 87, 90], "lock": 57, "log": [7, 20, 28, 35, 46, 50, 90], "log_directori": 87, "logger": 46, "logic": [12, 74], "login": 25, "login1": 72, "lognam": [72, 83, 84, 87], "logo": 18, "lokybackend": [20, 28], "lon": [8, 23, 25, 37, 38, 41, 46, 51, 61, 65, 72, 73, 80, 81, 83, 84, 87], "lon2d": 83, "lon_b": 61, "lon_bnd": [46, 61], "lon_bndsarrai": 61, "lon_corn": 61, "lon_shap": 61, "lonb": 83, "long": [2, 8, 10, 14, 15, 17, 20, 30, 32, 38, 43, 45, 46, 62, 63, 68, 73, 74, 78, 88], "long_nam": [7, 11, 17, 20, 23, 36, 37, 38, 39, 41, 43, 46, 47, 61, 68, 72, 80, 81, 83, 84, 86, 87], "long_term_averag": 20, "long_term_mean": 20, "longer": [7, 8, 10, 12, 14, 29, 63, 68, 79], "longest": 20, "longitud": [17, 23, 51, 61, 67, 72, 73, 80, 81, 83, 86], "longitude_chunks": 46, "longitudeactual_rang": 81, "longitudearrai": 41, "longitudeaxi": 81, "longitudedescript": 67, "longitudelong_nam": [61, 87], "longitudestandard_nam": 41, "longitudesunit": [39, 61], "longitudeunit": [23, 38, 41, 46, 61, 72, 80, 83, 84, 86, 87], "longwav": [36, 41, 63], "lonpandasindexpandasindex": [72, 81, 83, 84, 87], "look": [0, 6, 8, 11, 12, 15, 17, 18, 20, 23, 24, 25, 28, 29, 35, 36, 39, 41, 42, 43, 46, 50, 51, 57, 59, 61, 63, 65, 67, 69, 72, 74, 75, 77, 80, 81, 83, 84, 85, 86, 87, 88, 90], "loom": 15, "loop": [7, 13, 14, 16, 31, 37, 47, 50, 67, 80, 83, 87], "lose": 45, "lossi": 38, "lost": 74, "lot": [6, 8, 10, 12, 15, 29, 45, 63, 72, 73, 74, 86, 89, 90], "low": [24, 88], "low_memori": [37, 41], "lower": 68, "lowercas": 37, "lowest": 37, "lr": [36, 50, 73], "lstsq": 73, "lt": [17, 23, 38, 39, 41, 46, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "ltrh": 71, "lu_index": 67, "luca": [8, 32, 86], "luck": 74, "lucki": [8, 90], "luckili": [81, 87], "lump": 67, "lunch": [77, 88], "lunit": 41, "lustr": [84, 87], "lvvvvvvaap": 86, "lwcf": 41, "m": [0, 1, 7, 14, 15, 17, 23, 38, 40, 41, 43, 46, 47, 51, 61, 65, 67, 68, 71, 72, 74, 80, 83, 84, 86, 87, 88], "m2": [36, 46, 72, 83, 84, 86], "m222qwsu": 41, "m2arrai": 46, "m2xarrai": 46, "m3": [67, 86], "mac": [12, 45], "machin": [2, 7, 18, 28, 32, 35, 52, 57, 62, 63, 75], "made": [7, 8, 12, 31, 37, 44, 48, 66, 80, 82, 88], "magic": [7, 68, 86], "magma": [23, 39, 41, 68], "mai": [0, 2, 6, 7, 8, 11, 13, 15, 17, 20, 24, 25, 29, 33, 34, 35, 38, 40, 41, 43, 45, 56, 57, 58, 60, 62, 63, 68, 70, 74, 78, 79, 81, 82, 84, 87, 89], "mail": 15, "main": [0, 8, 17, 23, 39, 44, 46, 50, 59, 61, 62, 72, 73, 75, 77, 82, 83, 84, 85, 86], "maintain": [8, 11, 23, 63, 70, 71, 78, 90], "mainten": [2, 63], "maintitl": 81, "major": [2, 59, 81], "make": [0, 1, 2, 4, 6, 7, 8, 10, 11, 12, 15, 16, 17, 18, 21, 22, 23, 24, 25, 28, 29, 30, 31, 35, 37, 39, 44, 45, 50, 51, 52, 57, 58, 59, 62, 63, 67, 68, 70, 71, 72, 73, 74, 75, 76, 78, 86, 88, 89, 90, 91], "mam": [41, 81], "mam3_0": 83, "mam3_0000": 83, "mamba": 71, "manag": [7, 8, 12, 14, 22, 24, 25, 29, 63, 81, 92], "mani": [2, 7, 8, 10, 11, 12, 15, 17, 20, 22, 24, 25, 29, 31, 35, 39, 43, 46, 47, 48, 52, 60, 61, 62, 68, 73, 79, 86, 87, 88, 89, 90, 92], "manifest": 7, "manipul": [8, 11, 16, 48, 86], "manner": 80, "manual": [28, 45, 80], "map": [8, 18, 23, 31, 38, 39, 41, 48, 60, 63, 71, 86, 92], "map_block": [8, 32, 80], "map_fil": 83, "map_method": [72, 83], "map_ne120_to_0": [72, 83], "map_path": 83, "map_proj": 67, "mapfac_m": 67, "mapfac_mi": 67, "mapfac_mx": 67, "mapfac_u": 67, "mapfac_ui": 67, "mapfac_ux": 67, "mapfac_v": 67, "mapfac_vi": 67, "mapfac_vx": 67, "mapfactor": 67, "mapfil": [72, 83], "mar": [41, 71, 83], "marbl": [18, 28, 32, 37, 44, 47], "march": [8, 11, 41, 49, 54, 60, 70, 81], "margin": 63, "maria": 32, "mark": 45, "markdown": 39, "marker": 47, "market": [15, 63], "marrai": [46, 80], "marshal": 89, "martin": 89, "martinez": 76, "mask": [31, 63, 68, 80], "mask_a": [72, 83], "mask_b": [72, 83], "mass": [67, 86], "massiv": [8, 37], "master": [18, 36, 38], "match": [11, 15, 41, 61, 74, 81, 87], "materi": [1, 6, 8, 59, 65, 66, 77, 87], "math": [8, 16, 69], "mathwork": 63, "matplotlib": [8, 19, 21, 23, 34, 37, 39, 41, 43, 46, 47, 54, 60, 61, 72, 73, 80, 81, 84, 92], "matplotlib_tutori": 49, "matplotlibdeprecationwarn": 68, "matric": 25, "matrix": [44, 80], "matt": [2, 8, 10, 30, 32, 43], "matter": 83, "matthew": [8, 10], "max": [2, 8, 31, 32, 39, 40, 43, 48, 58, 61, 65, 73, 80, 88, 89], "max_diff": 61, "maximum": [28, 37, 48, 67, 87], "maximum_job": [83, 87], "mayb": [15, 25, 47, 88, 90], "mb": [7, 17, 41, 43, 61], "mbar": 37, "mbound": 72, "mcdate": 80, "mcsec": 80, "mct": 61, "md": [0, 1, 8, 64, 75], "mdcur": 80, "mdescript": 67, "mdim": [41, 84], "mdt": [8, 41, 66, 72, 83, 84], "mdtf": [24, 44], "me": [8, 11, 12, 15, 74], "mea": 91, "mean": [7, 10, 11, 12, 13, 14, 15, 20, 23, 24, 25, 28, 29, 31, 35, 37, 39, 44, 63, 67, 68, 72, 73, 74, 80, 81, 83, 84, 86, 87, 92], "meancoordin": 68, "meangrid_loc": 61, "meangrid_map": 61, "meaning": 23, "meaningless": 46, "meaninterp_method": 86, "meanlong_nam": [38, 46, 84, 86], "meanparent_stat": 81, "meansstandard_nam": 41, "meanstandard_nam": 81, "meant": [8, 31, 35, 67, 90], "meanxarrai": [41, 80, 87], "measur": [11, 46, 61, 63], "mecj2384": 41, "medeiro": 32, "median": 46, "meet": [8, 12, 29, 32, 59, 75, 77, 79, 90], "melodi": 24, "mem": [22, 43, 46, 52, 87], "member": [6, 7, 8, 10, 32, 37, 40, 43, 46, 47, 68, 84, 87, 90], "member_id": [20, 37, 38, 39, 41, 43, 46, 47, 61, 68], "membersprecis": 46, "memori": [8, 12, 14, 17, 20, 22, 25, 37, 38, 41, 43, 46, 47, 52, 61, 62, 67, 68, 73, 80, 83, 84, 86, 87], "men": 63, "mention": [8, 11, 12, 28, 32, 37, 39, 47, 57, 61, 62, 67, 68, 84], "mentor": [29, 74], "menu": 18, "menu_background": 18, "menu_text": 18, "merg": [0, 18, 35, 38, 39, 42, 46, 47, 63, 65, 72, 83, 86], "merge_ds_cmip6": 46, "merge_ds_smbb": 46, "merge_var": 86, "merged_d": 39, "meridion": [38, 86], "merra_12_climo": 41, "merraw_19x2_09_climo": 41, "mesa": [8, 30, 75, 77, 85, 90, 91], "mesh": [23, 30, 72, 90], "meshgrid": 23, "mesonet": 63, "mesoscal": [40, 67], "mess": 86, "messag": [0, 6, 7, 12, 45, 80], "met": [8, 10, 63], "meta": [17, 28, 38, 39, 41, 46, 61, 67, 68, 72, 73, 74, 80, 83, 84, 86, 87], "metadata": [8, 28, 36, 64, 72, 80, 84, 86, 87], "metadata_link": 61, "metar": 40, "meteorolog": [23, 81], "meteorologi": [40, 67], "meter": [61, 65, 67, 86], "meters2": 67, "metersarrai": 86, "metersaxi": 61, "metersdescript": 67, "metgrid": 67, "method": [1, 7, 8, 11, 12, 25, 28, 29, 36, 37, 38, 39, 41, 46, 47, 50, 51, 53, 65, 67, 68, 72, 73, 74, 81, 86, 87, 90], "metoffic": 46, "metpi": [7, 8, 32, 40, 63, 65], "metplu": 24, "metric": [8, 47], "mgeospatial_vertical_resolut": 61, "mgrover": [20, 28, 37, 38, 39, 41, 46, 50, 61, 62, 67, 68], "mgrover1": [50, 58], "mi2rvi7_": 37, "mib": [38, 39, 41, 46, 61, 67, 68, 72, 73, 80, 83, 84, 86, 87], "michael": 10, "michaela": [8, 21], "michaelav": 21, "michaelsa": [8, 21], "micropuls": 63, "microscal": 67, "microsoft": 84, "mid": [8, 32, 37], "middl": 18, "midpoint": [38, 39, 41, 46, 61, 68, 72, 83, 84], "might": [7, 8, 15, 38, 39, 42, 44, 46, 73, 74, 88], "mike": [2, 32, 91], "mileston": 59, "millet": 80, "million": [37, 63], "mimick": 83, "min": [48, 61, 63, 84], "min_diff": 61, "mind": [8, 15, 20, 38, 39, 61, 62], "mine": [8, 15], "miniconda": [7, 8, 12, 45, 71, 75], "miniconda3": [28, 37, 38, 41, 61, 67, 68, 80, 84, 87], "minim": [7, 20, 28, 41, 43, 61, 83, 84, 87], "minimum": [25, 32, 37, 44, 48, 63, 64], "minimum_job": [83, 87], "minor": [68, 81], "minu": 61, "minut": [20, 47, 65], "misbehav": 7, "miscanthu": 80, "mishonov": 61, "mismatch": 47, "misrcosp_jja_climo": 41, "miss": [11, 13, 42, 62, 63, 68, 73], "mission": 2, "misunderstood": [8, 74], "mix": [8, 37, 41, 72, 83, 84, 86], "mixpod": 86, "mixpodsdimens": 86, "mkdir": [50, 86], "ml": 77, "mlab": 65, "mld": 47, "mld_dsigma": 47, "mld_sigma": 47, "mld_stack": 47, "mlotst": 86, "mlsg_10_climo": 41, "mlso_ann_climo": 41, "mlsw": 41, "mlsw_mam_climo": 41, "mm": 11, "mmm": 2, "mnmean": 81, "mnt": [84, 87], "mobil": 40, "mode": [17, 44, 71, 83, 84], "model": [2, 6, 8, 10, 11, 17, 20, 23, 24, 28, 30, 32, 36, 37, 38, 39, 40, 42, 44, 46, 47, 62, 67, 72, 73, 75, 76, 83, 90], "model_d": 61, "model_document": 50, "model_doi_url": [28, 39, 61, 68, 84, 87], "model_monthly_mean": 61, "modelhostnam": 80, "modern": [2, 8, 10], "modi": 67, "modif": [51, 87], "modifi": [7, 8, 15, 20, 39, 43, 44, 53, 72, 73, 84, 86, 87], "modified_igbp_modis_noahnum_land_cat": 67, "modify_markdown_head": 44, "modis_ann_climo": 41, "modul": [7, 8, 16, 69, 71, 80, 87], "modular": [24, 30, 31], "mohammad": 10, "moistur": 67, "molina": 32, "mom1": 87, "mom1initial_fil": 87, "mom2": [84, 87], "mom2initial_fil": [84, 87], "mom6": [8, 24], "moment": [11, 84], "momentum": 74, "mon": 46, "monclim": 47, "mondai": [6, 8, 32, 63], "monei": [29, 63], "monet": 24, "monitor": 25, "monkei": 83, "mont": 41, "month": [8, 16, 20, 30, 31, 39, 41, 46, 47, 59, 61, 65, 68, 80, 81, 88], "month_1": [20, 28, 39, 41, 61, 68, 80], "month_1cont": 61, "month_1model_doi_url": 39, "month_1time_constant_3dvars_filenam": 80, "month_1xarrai": 68, "month_length": 68, "month_numb": 41, "monthli": [6, 8, 32, 36, 38, 42, 46, 67, 68, 80, 86], "monthly_averag": 20, "monthly_obs_d": 41, "monthly_obs_plot": 41, "monthly_ocean_histori": 20, "monthly_ocean_timeseri": 20, "monthlyintake_esm_attr": 38, "monthlyxarrai": 38, "moor": 63, "more": [2, 4, 6, 7, 8, 10, 11, 12, 13, 15, 16, 17, 20, 24, 25, 28, 29, 32, 34, 37, 38, 39, 40, 41, 44, 45, 46, 47, 52, 57, 59, 60, 62, 63, 64, 65, 67, 68, 71, 74, 75, 80, 81, 84, 86, 87, 88, 90], "moreov": 2, "morn": [63, 76, 88], "most": [2, 4, 7, 8, 10, 25, 28, 30, 31, 32, 37, 48, 61, 62, 63, 68, 69, 74, 75, 79, 80, 89], "mostli": [12, 24, 63, 73, 88, 90], "motion": 63, "motiv": [8, 15, 25, 29, 40, 42, 44, 59, 63, 80], "mount": [12, 15], "mountain": [8, 16, 19, 21, 26, 27, 33, 34, 35, 40, 49, 54, 55, 56, 58, 60, 66, 70, 78, 82], "mous": [8, 74], "move": [7, 8, 12, 15, 19, 23, 24, 25, 26, 27, 29, 32, 40, 50, 55, 56, 61, 62, 63, 66, 67, 70, 74, 78, 79, 84], "movement": 25, "mozilla": 63, "mpa": [39, 90], "mpg": 87, "mph": 65, "mpi": 25, "mpimet": 87, "mpl": 80, "mpl2nc": 63, "mq0h46t1": 73, "mscur": 80, "msldescript": 67, "msr_x": 67, "mt": [6, 16, 32], "much": [2, 8, 10, 20, 25, 29, 45, 50, 52, 62, 63, 68, 69, 73, 83, 84, 87, 90], "mudryk": 38, "mudryknco_openmp_thread_numb": 38, "multi": [7, 8, 15, 16, 70], "multidimension": 23, "multimedia": 91, "multipl": [8, 16, 30, 39, 42, 51, 53, 62, 63, 65, 69, 82, 86, 87, 90], "multipli": [46, 61, 68, 73], "multizarr_profil": 84, "multizarrtozarr": [84, 86], "must": [1, 6, 8, 10, 13, 14, 15, 36, 52, 53, 61, 72, 80, 83], "muszala": 80, "mutablemap": 86, "mutat": 53, "my": [8, 11, 12, 15, 17, 45, 62, 63, 69, 71, 74, 86], "my_env": 45, "my_environ": 7, "my_usernam": 7, "myenv": 71, "myself": [8, 15, 62, 74, 90], "mzz": [84, 86], "n": [7, 11, 13, 23, 28, 37, 46, 47, 50, 61, 65, 67, 71, 72, 73, 80, 81, 83, 86], "n02_ctsm1": 80, "n2o": [72, 83, 84], "n2ovmr": [72, 83, 84], "n_": [72, 83], "n_a": [72, 83], "n_b": [72, 83], "n_job": [20, 28], "naiv": [73, 81], "name": [1, 7, 12, 13, 14, 15, 19, 20, 21, 23, 26, 27, 28, 33, 34, 35, 38, 39, 40, 41, 44, 45, 47, 49, 50, 51, 54, 55, 56, 57, 58, 60, 61, 64, 66, 67, 69, 70, 71, 72, 73, 74, 78, 80, 81, 82, 83, 84, 86, 87, 88], "nan": [7, 18, 36, 41, 46, 47, 61, 68, 80, 83], "nanarrai": [61, 80], "nandataset": 46, "nanlong_nam": [46, 61], "nanmax": 61, "nanmin": 61, "nanni": [37, 41, 62, 73, 86], "nano": 12, "nanr": [72, 83], "nanr_forkati": 83, "nanrhost": 72, "narr": [2, 8, 71], "narrai": 46, "nasa": 41, "nation": [8, 37, 56, 59, 61, 63], "nativ": [15, 25, 39, 53, 90], "natur": [10, 23, 47, 80], "nav": 88, "navbar": 88, "navig": [0, 1, 8, 11, 19, 21, 26, 27, 33, 34, 58, 59, 66, 75, 86, 88], "nbdate": [72, 83, 84], "nbedrock": 80, "nbf": 44, "nbformat": 44, "nbnd": [23, 38, 46, 51, 72, 83, 84], "nbound": 61, "nbsec": [72, 83, 84], "nbyte": 87, "nc": [7, 17, 20, 23, 28, 41, 43, 46, 47, 61, 65, 67, 72, 80, 81, 83, 84, 86, 87], "ncar": [0, 1, 2, 6, 8, 10, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 30, 32, 33, 34, 35, 36, 37, 38, 39, 40, 43, 46, 49, 50, 54, 55, 56, 58, 59, 60, 61, 62, 66, 67, 68, 70, 71, 72, 78, 82, 83, 84, 85, 86, 88, 90, 91, 92], "ncar_jobqueu": [8, 20, 22, 37, 38, 39, 41, 46, 47, 52, 61, 62, 67, 68, 83, 84], "ncar_pandas_tutori": 58, "ncarclust": [20, 37, 38, 39, 41, 46, 47, 52, 61, 62, 67, 68, 83, 84], "ncat": 17, "nccvs_revis": [72, 83], "ncdomain_b": [72, 83], "ncdump": 87, "ncei": 61, "nceisea_nam": 61, "ncep": 81, "ncgd0011": 87, "ncgrid_file_dst": [72, 83], "ncgrid_file_src": [72, 83], "ncgrid_til": 86, "ncinitial_conditions_dataset": 80, "ncinstitut": 17, "ncintake_esm_attr": 38, "nck": [17, 23, 41], "ncl": [24, 81, 92], "nclognam": [38, 84], "ncltype_vegetated_or_bare_soil": 80, "ncmodel_doi_url": [84, 87], "ncnaming_author": 61, "ncnco": [23, 41, 87], "nco": [23, 38, 41, 51, 83, 87, 90], "nco_openmp_thread_numb": 17, "ncol": [8, 23, 51, 72, 83], "ncpft_physiological_constants_dataset": 80, "ncpu": [22, 43, 46, 52, 87], "ncrcat": 87, "ncremap": [83, 90], "nctime_constant_3dvar": 80, "nctopography_fil": [23, 72, 83, 84, 87], "ncvi": 90, "nd": [28, 80], "ndarrai": [17, 28, 38, 39, 41, 46, 61, 67, 68, 72, 73, 80, 83, 84, 86, 87], "nday1": 20, "ndbase": [72, 83, 84], "ndcur": [72, 83, 84], "ndim": [80, 87], "ndimag": 63, "ne": [23, 51, 72, 83], "ne120": [72, 83], "ne120_g16": 83, "ne120_t12": [23, 51, 72], "ne120np4_l30_c110928": 83, "nearest": [37, 68, 90], "neccessari": [8, 23, 43, 44], "neccessarili": [20, 28, 46, 67, 84], "necessari": [0, 7, 8, 12, 14, 19, 21, 26, 27, 35, 40, 43, 45, 49, 54, 55, 56, 58, 66, 69, 70, 78, 86], "necessarili": 14, "nedit": 12, "need": [1, 2, 6, 7, 8, 10, 11, 12, 13, 14, 15, 16, 17, 20, 23, 24, 25, 28, 29, 31, 35, 37, 38, 42, 43, 45, 46, 50, 51, 52, 57, 61, 63, 65, 67, 68, 69, 71, 72, 73, 77, 79, 80, 81, 84, 85, 86, 87, 88, 90], "needleleaf_deciduous_boreal_tre": 80, "needleleaf_evergreen_boreal_tre": 80, "needleleaf_evergreen_temperate_tre": 80, "neeed": 12, "negin": [89, 91], "neglgibl": 81, "neighbor": [15, 90], "neither": [81, 87], "nesdi": 61, "nest": [67, 87], "net": [23, 36, 41, 63, 87], "netcdf": [7, 8, 20, 23, 25, 28, 29, 32, 37, 39, 41, 46, 51, 61, 63, 65, 68, 83, 86, 87], "netcdf3": 86, "netcdf3tozarr": 86, "netcdf4": [8, 65, 67, 84], "network": [2, 36, 63, 73], "never": [11, 13, 15], "new": [0, 2, 4, 6, 8, 10, 11, 12, 15, 18, 25, 28, 29, 30, 31, 32, 35, 36, 39, 43, 45, 50, 53, 55, 67, 70, 71, 72, 73, 74, 78, 80, 84, 86, 91], "new_d": 17, "new_notebook": 44, "new_tim": 65, "newest": [8, 52], "newref": 86, "next": [4, 8, 11, 12, 13, 16, 19, 20, 21, 24, 26, 27, 33, 34, 35, 39, 40, 45, 47, 49, 50, 54, 55, 56, 57, 58, 59, 60, 62, 63, 66, 67, 68, 70, 72, 78, 79, 82, 88], "nh4": 44, "nhug": 6, "nice": [14, 15, 72, 80, 90], "nicer": 39, "nichola": 89, "nick": [76, 91], "night": [8, 15], "nihanth": 91, "njob": [20, 28, 41], "nlat": [20, 28, 39, 47, 61, 68], "nlat_b": 61, "nlcd": 67, "nlon": [20, 28, 39, 47, 61, 68], "nlon_b": 61, "nlong_nam": 86, "nlonxarrai": 68, "nnz": [80, 83], "nnz104414density0": 80, "nnz2654208density3": 83, "nnz3density0": 80, "nnz417656density0": 80, "nnzval": 83, "no3": 44, "no_convert": 44, "noaa": [46, 61, 63, 81], "noah": 67, "nobodi": 90, "nodc": 61, "nodc_netcdf_grid_template_v2": 61, "nodc_template_vers": 61, "node": [1, 8, 25, 30, 36, 38, 43, 50, 68, 71, 84, 87], "nodefault": 7, "nodej": 45, "noleap": [11, 41, 61, 72, 83, 84, 86, 87], "noleapcartesian_axi": 86, "nomin": 86, "non": [11, 12, 25, 53, 63, 67, 80, 84, 87], "non_vertical_dim": 47, "none": [14, 17, 20, 28, 39, 46, 61, 65, 80, 81, 86, 87], "nonearrai": 86, "nonedescript": 67, "noneintake_esm_dataset_kei": 46, "nonelong_nam": 86, "nonemodel_doi_url": 61, "nonetime_period_freq": 39, "nor": 87, "normal": [72, 83, 87], "north": [41, 48, 67, 86], "north_grid_dimens": 67, "north_patch_end_stag": 67, "north_patch_end_unstag": 67, "north_patch_start_stag": 67, "north_patch_start_unstag": 67, "northeast": 61, "northunit": 86, "northwest": 61, "not_veget": 80, "notabl": 2, "notat": [13, 61], "note": [0, 1, 6, 8, 13, 14, 15, 20, 22, 25, 27, 28, 39, 40, 42, 46, 47, 61, 63, 72, 76, 80, 81, 83, 84, 86, 90, 92], "notebook": [0, 4, 6, 7, 8, 12, 18, 20, 21, 25, 39, 40, 43, 46, 48, 49, 50, 53, 54, 55, 57, 59, 60, 62, 63, 66, 67, 73, 75, 80, 82, 83, 86, 90, 91, 92], "notebook_nam": 44, "notic": [8, 13, 15, 16, 23, 28, 38, 41, 42, 43, 44, 46, 51, 61, 65, 67, 68, 71, 74, 79, 80, 81, 87, 90], "notimplementederror": 80, "nov": [72, 86], "novel": 2, "novemb": [8, 16, 56, 75, 76, 77], "now": [6, 7, 8, 15, 17, 18, 22, 23, 25, 28, 31, 32, 37, 38, 39, 41, 42, 43, 46, 47, 50, 51, 57, 61, 63, 65, 67, 68, 71, 72, 73, 74, 79, 80, 81, 83, 84, 86, 87, 89], "nowher": 15, "np": [17, 23, 28, 38, 39, 41, 43, 46, 47, 51, 61, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "npartit": 86, "npft": 80, "npm": 1, "nsbase": [72, 83, 84], "nscur": [72, 83, 84], "nsf": [2, 6, 8, 91, 92], "nstep": 80, "nsteph": [72, 83, 84], "nt": 73, "ntrk": [46, 72, 83], "ntrm": [46, 72, 83], "ntrn": [46, 72, 83], "nuanc": 4, "null": 86, "num_metgrid_level": 67, "num_nod": [36, 50], "num_sm_lay": 67, "num_st_lay": 67, "num_year": 20, "number": [7, 8, 15, 17, 20, 22, 23, 28, 31, 36, 37, 41, 42, 43, 47, 50, 52, 53, 61, 63, 65, 68, 73, 80, 81, 86, 87, 88], "number_of_observationslong_nam": 61, "numberunit": 86, "numer": [8, 14, 20, 29, 37, 53, 59, 62, 68], "numfocu": 63, "numpi": [7, 8, 17, 23, 38, 39, 41, 43, 45, 46, 47, 49, 60, 61, 63, 67, 68, 70, 72, 73, 75, 76, 77, 80, 81, 83, 84, 86, 87], "nurtur": 78, "nv": 86, "nv_a": [72, 83], "nv_b": [72, 83], "nvap_03_climo": 41, "nvpandasindexpandasindex": 86, "nwj08h26": 41, "nx": 73, "ny": 73, "o": [10, 43, 44, 47, 61, 84, 87], "o2": 44, "o3": 41, "o_o": 80, "oa1": 67, "oa1l": 67, "oa1ss": 67, "oa2": 67, "oa2l": 67, "oa2ss": 67, "oa3": 67, "oa3l": 67, "oa3ss": 67, "oa4": 67, "oa4l": 67, "oa4ss": 67, "ob": [46, 61, 68, 84], "obj": 42, "object": [7, 8, 11, 12, 13, 17, 18, 22, 23, 24, 25, 28, 36, 37, 38, 39, 41, 46, 50, 51, 53, 60, 61, 63, 64, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "object0021": 23, "object0024": 61, "object0046": 86, "object1700": 80, "object1850": 46, "object1860": 41, "object1920": 72, "object1970": 84, "object1980": 17, "object2000": [83, 87], "object2006": 38, "object2015": 68, "objectdask": [38, 68, 72, 80, 83, 84, 86, 87], "obs_": 46, "obs_catalog": 41, "obs_catalog_subset": 41, "obs_d": 61, "obs_data": [8, 41], "obs_df": 46, "obs_sum": [46, 68], "obsdataurl": 46, "observ": [8, 24, 32, 40, 63, 65], "observationvalid_rang": 46, "obtain": [15, 46], "obviou": 81, "obvious": [13, 15, 24], "oc": [47, 86], "oc5": 61, "occupi": 14, "occur": [11, 15], "occurr": [11, 15], "ocean": [8, 18, 24, 28, 39, 42, 43, 63, 68, 80, 82, 86], "ocean_mass_x_transporttime_avg_info": 86, "ocean_mass_y_transporttime_avg_info": 86, "ocean_mixed_layer_thickness_defined_by_sigma_ttime_avg_info": 86, "ocean_tim": 73, "ocean_timexarrai": 73, "ocean_volumetime_avg_info": 86, "oceanograph": [23, 70], "ocn": [20, 28, 36, 39, 43, 44, 61, 68, 86], "octob": [8, 10, 16, 19, 30, 46, 63], "odd": [15, 61], "off": [8, 15, 16, 37, 42, 50, 68, 82, 91], "offer": [8, 16, 29, 32, 36, 38, 44, 62, 63], "offic": [2, 7, 8, 10, 23, 74, 91], "offici": [28, 50, 57, 65], "offlin": [72, 83], "often": [1, 8, 28, 38, 59, 61, 62, 64, 69, 74, 80, 87], "oftentim": 74, "oi": 81, "oil": 15, "oilpalm": 80, "oisst": 63, "ok": [61, 73], "okai": [25, 74], "ol1": 67, "ol1l": 67, "ol1ss": 67, "ol2": 67, "ol2l": 67, "ol2ss": 67, "ol3": 67, "ol3l": 67, "ol3ss": 67, "ol4": 67, "ol4l": 67, "ol4ss": 67, "older": [24, 81], "omip": 42, "omip1": 42, "omit": 12, "oml": 86, "omon": 42, "onc": [0, 12, 20, 23, 28, 36, 40, 41, 50, 52, 57, 59, 62, 63, 64, 67, 71, 75, 80, 86, 90], "one": [7, 8, 11, 12, 13, 16, 17, 24, 28, 29, 31, 32, 35, 36, 39, 41, 43, 44, 45, 46, 49, 50, 51, 54, 57, 59, 61, 62, 63, 64, 67, 68, 71, 72, 73, 74, 76, 78, 79, 80, 81, 85, 86, 87, 88, 90, 92], "ones": [46, 68], "ones_out": [46, 68], "ones_sum": 68, "ongo": [32, 90, 92], "onli": [0, 7, 8, 10, 12, 13, 15, 18, 20, 25, 28, 38, 39, 41, 43, 44, 45, 46, 51, 53, 61, 63, 64, 67, 69, 72, 73, 80, 83, 84, 87, 88, 90], "onlin": [8, 10, 15, 18, 50, 62, 77, 89, 91], "online1": [23, 51], "onlytruesize14": 80, "onlytruesize2": 80, "onlytruesize3": 80, "onlytruesize48storag": 80, "onlytruesize50": 83, "onlytruesize60storag": 80, "onlytruesize72storag": 80, "onto": [22, 39, 60], "oop": 87, "oop_hrrr_tutori": [8, 55], "oop_tutori": 55, "open": [0, 1, 2, 6, 7, 8, 10, 12, 23, 24, 25, 29, 30, 36, 41, 42, 44, 45, 50, 56, 57, 59, 64, 67, 70, 76, 78, 82, 84, 86, 88, 90, 91], "open_dataset": [7, 8, 11, 17, 23, 41, 46, 47, 61, 65, 67, 72, 80, 81, 83, 84, 87], "open_datatre": 86, "open_esm_datastor": [20, 28, 36, 37, 38, 39, 41, 42, 43, 46, 50, 61], "open_mfdataset": [7, 8, 17, 65, 67, 84, 86, 87], "open_zarr": [61, 68, 86], "opendap": [8, 37], "openli": [57, 61], "oper": [6, 7, 11, 14, 16, 20, 23, 25, 39, 51, 62, 63, 83, 87, 92], "opportun": [2, 8, 25, 43, 62, 63, 89, 90], "opportunti": 39, "oppos": [8, 12, 39], "opt": [22, 23, 39, 43, 46, 52, 61, 65, 71, 83, 87], "optic": 72, "optim": [8, 25, 31, 41, 47, 62], "optimum": [63, 81], "option": [1, 7, 8, 11, 12, 20, 23, 28, 31, 37, 39, 41, 42, 45, 47, 50, 51, 57, 62, 64, 67, 83, 88, 92], "orang": [7, 43], "order": [8, 10, 11, 13, 14, 28, 29, 30, 38, 43, 47, 48, 63, 68, 83, 85, 86, 87], "ordered_dsets_kei": 43, "org": [18, 28, 39, 59, 61, 63, 68, 69, 80, 84, 87], "organ": [2, 7, 8, 10, 12, 25, 40, 59, 63, 70, 76, 78, 89, 90], "orhan": [2, 30, 32, 76, 77, 91], "orient": [2, 8, 36, 44, 50, 60, 74, 80, 81], "origin": [0, 15, 18, 29, 39, 44, 46, 61, 71, 73, 83, 86], "orograph": 67, "orographi": 67, "orographystagg": 67, "orthogon": 87, "oss": 63, "other": [0, 6, 7, 8, 12, 14, 15, 16, 20, 24, 25, 28, 29, 38, 39, 41, 44, 46, 47, 50, 51, 53, 57, 59, 62, 63, 64, 68, 70, 71, 73, 78, 79, 80, 82, 83, 86, 87, 88, 92], "otherwis": [45, 86], "ouch": 73, "ouput": 18, "our": [2, 7, 8, 10, 13, 14, 15, 16, 17, 18, 20, 25, 28, 29, 30, 31, 32, 35, 36, 40, 41, 43, 51, 59, 61, 62, 63, 67, 68, 69, 73, 77, 80, 81, 82, 84, 85, 87, 88, 89, 90, 91], "ourselv": 7, "out": [6, 7, 8, 10, 11, 12, 15, 16, 23, 24, 25, 28, 29, 30, 31, 32, 36, 37, 38, 39, 43, 44, 45, 50, 57, 59, 62, 63, 64, 65, 67, 68, 71, 73, 74, 75, 78, 79, 80, 81, 83, 85, 86, 88, 90], "out_lat": 61, "out_lon": 61, "out_notebook_nam": 44, "out_shap": [61, 72, 83], "outf": 84, "outfil": 12, "outlin": [3, 32, 59, 61, 77], "output": [8, 15, 18, 23, 24, 25, 28, 30, 31, 32, 36, 37, 43, 44, 51, 61, 62, 71, 72, 73, 81, 87, 90, 92], "output_core_dim": 80, "output_dtyp": 80, "output_s": [61, 80], "outputsunit": 72, "outputunit": 72, "outsid": [8, 15, 23, 24, 25, 29, 89], "over": [6, 7, 8, 12, 13, 14, 20, 23, 37, 39, 41, 42, 43, 44, 45, 46, 47, 48, 50, 60, 61, 62, 63, 67, 68, 74, 75, 77, 80, 81, 83, 86, 87, 88], "overal": [24, 52, 88, 90], "overburden": 88, "overcom": [8, 74, 88], "overflow": [45, 74], "overhead": 62, "overlap": [8, 90], "overrid": [7, 20, 28, 41, 43, 61, 84, 87], "overtaken": 63, "overview": [6, 8, 28, 64, 88], "overwhelm": 42, "overwrit": 14, "own": [6, 7, 8, 11, 15, 16, 17, 24, 25, 29, 45, 50, 59, 62, 71, 74, 75, 76, 90], "oxygen": [25, 32], "p": [8, 18, 38, 41, 46, 47, 48, 50, 61, 63, 71, 72, 73, 80, 81, 83, 84, 90], "p0": [38, 41, 46, 72, 83, 84, 87], "p01mgeospatial_lat_min": 61, "p3jqok8h": 73, "p63ytime_coverage_resolut": 61, "pa": [72, 83, 84], "paarrai": 46, "pacakg": 7, "pacif": 81, "pack": [57, 63], "packag": [6, 7, 8, 12, 14, 16, 18, 21, 22, 23, 25, 26, 27, 28, 35, 36, 37, 38, 41, 42, 44, 45, 47, 49, 52, 53, 54, 55, 57, 58, 60, 61, 63, 66, 67, 68, 70, 71, 72, 74, 77, 80, 82, 83, 84, 85, 86, 87, 92], "package_nam": 7, "packagehistori": 41, "pad": [31, 48], "padescript": 67, "page": [6, 8, 15, 28, 30, 31, 32, 37, 39, 44, 59, 79, 88, 92], "pai": [15, 73], "pain": [8, 11, 25, 29, 31, 86], "pair": [8, 29, 32, 71], "palm": 15, "pan": 39, "panda": [8, 11, 18, 20, 23, 25, 41, 42, 43, 46, 59, 63, 65, 68, 74], "pane": [18, 39], "panel": [0, 18, 39], "panelifi": 18, "pangeo": [2, 4, 7, 8, 10, 11, 29, 30, 31, 32, 46, 63, 70, 72, 82, 83], "paper": [2, 8, 25, 46, 63, 64, 71], "papermil": [8, 44], "papermill_runn": 71, "paradigm": [2, 10], "parallel": [8, 10, 20, 24, 28, 32, 47, 62, 67, 71, 72, 73, 80, 84, 86, 87], "param": [71, 84], "paramdata": 80, "paramet": [23, 28, 41, 44, 46, 47, 51, 52, 61, 67, 71, 72, 80, 83, 86], "parameter": 71, "parameteriz": 44, "parameterstagg": 67, "parametr": 71, "parasol": 72, "parellel": [8, 62], "parent": [12, 36, 86], "parent_stat": 81, "parenthes": 50, "parenthesi": 45, "pars": [20, 28, 40, 67, 90, 92], "parse_amwg_ob": 41, "parse_cesm_histori": 28, "parser": 28, "parsing_func": 28, "parsing_func_kwarg": 28, "part": [8, 10, 12, 15, 16, 22, 23, 25, 26, 27, 28, 38, 40, 44, 50, 51, 61, 63, 66, 82, 88], "parti": 16, "particip": [2, 8, 16, 63, 76, 77, 85, 90, 91], "particul": 7, "particular": [2, 15, 23, 38, 80, 83, 86, 91], "particularli": [62, 73, 83], "partit": 62, "partner": [8, 32, 92], "partnership": [2, 8, 63, 90], "pass": [13, 28, 37, 41, 42, 61, 65, 67, 68, 74, 80], "passion": [8, 25, 56, 74, 78], "password": [7, 40, 57], "past": [7, 8, 12, 19, 21, 43, 49, 50, 58, 66, 71, 80], "patch": 83, "path": [8, 17, 20, 28, 36, 37, 38, 39, 41, 42, 45, 46, 57, 61, 63, 72, 83, 84, 86, 87], "path_column": 18, "path_column_nam": [20, 28, 41], "pathlib": [41, 86], "pathnam": 87, "patient": [74, 79], "pattern": [28, 61, 63, 87], "paul": [2, 8, 31, 35, 56, 76], "paver": 61, "payment": 15, "pb": [8, 32, 43, 52, 63, 87], "pbs_jobid": 87, "pbscluster": [8, 22, 37, 38, 41, 43, 46, 52, 61, 62, 67, 68, 83, 84, 87], "pco2surf": 28, "pcolor": 68, "pcolormesh": 68, "pd": [18, 20, 23, 41, 46, 65], "pdf": [48, 50, 59], "peaceiri": 44, "peak": 65, "pears": 91, "peer": 74, "pelican": 91, "pend": 7, "peopl": [8, 15, 24, 25, 29, 57, 62, 63, 68, 74, 79, 80, 83, 88, 89, 90], "per": [48, 62, 63, 67, 83, 86, 87, 88], "percent": [39, 67], "percentag": 67, "percentagestagg": 67, "percentdescript": 67, "percentil": 63, "percentstagg": 67, "perceptu": [8, 48], "perform": [7, 8, 10, 24, 32, 39, 43, 47, 51, 67, 73, 78, 84], "performance_report": [17, 20], "performancewarn": 67, "perhap": [38, 49, 68, 84, 87, 90], "period": [7, 20, 37, 44, 46, 61, 63, 72, 83, 86], "perman": 64, "permiss": [57, 88], "persever": 74, "persist": [25, 39, 47], "person": [6, 7, 8, 10, 15, 16, 49, 62, 63, 75, 77, 85, 88, 90], "perspect": [8, 74], "petabyt": 46, "peterson": [8, 76, 85, 91], "pfc": [23, 72, 83], "pft": 80, "pft_constant": 80, "pftflag_valu": 80, "pftformatcoodata": 80, "pftmask": 80, "pftname": 80, "pfts1d_activ": 80, "pfts1d_ci": 80, "pfts1d_gi": 80, "pfts1d_itype_col": 80, "pfts1d_itype_lunit": 80, "pfts1d_itype_veg": 80, "pfts1d_ixi": 80, "pfts1d_jxy": 80, "pfts1d_lat": 80, "pfts1d_li": 80, "pfts1d_lon": 80, "pfts1d_wtcol": 80, "pfts1d_wtgcell": 80, "pfts1d_wtlunit": 80, "pftxarrai": 80, "pg2oop": 56, "phenomena": 63, "philanthropi": 63, "philip": [76, 77, 91], "photo": 88, "photoc_diat_zint": 44, "photoc_diaz_zint": 44, "photoc_sp_zint": 44, "photoc_tot_zint": 44, "photosynthesi": 80, "physic": [8, 37, 44, 45, 67, 70, 90], "physicist": 56, "physics_": 44, "physics_salt": 44, "pi": [63, 73], "pick": [7, 11, 12, 87], "picontrol": [84, 87], "pictur": [24, 65], "piec": [8, 11, 28, 39, 62, 64], "pilotchut": [33, 55], "pin": 25, "ping": 88, "pint": [25, 80], "pip": [7, 15, 28, 38, 44, 50, 67, 69], "pipelin": [23, 31, 63], "pitch": [8, 10], "pjk": 38, "place": [4, 6, 7, 8, 15, 24, 32, 39, 42, 44, 50, 59, 62, 63, 69, 71, 80, 83, 86, 92], "placehold": 15, "plaform": [8, 57], "plai": 63, "plan": [8, 10, 24, 28, 29, 63, 71, 77], "plant": 80, "platecarre": [23, 80, 81], "platform": [7, 11, 24, 29, 31, 37, 46], "playist": 91, "pleas": [6, 8, 12, 16, 19, 21, 26, 27, 33, 34, 35, 38, 40, 49, 54, 55, 56, 58, 61, 66, 70, 75, 77, 78, 79, 82, 84, 85, 87, 88], "plenari": 76, "plenti": 90, "plev": 67, "plot": [8, 28, 30, 32, 33, 47, 48, 60, 63, 68, 71, 72, 73, 83, 87, 92], "plot_comparison": 39, "plot_field": 68, "plot_interact": 39, "plot_typ": 18, "plottl": 19, "plt": [30, 37, 39, 41, 43, 47, 48, 72, 73, 80, 81], "plu": [86, 90], "plug": [8, 80], "plugin": [25, 64, 92], "pm": [8, 16, 19, 21, 26, 27, 32, 33, 34, 35, 40, 44, 49, 54, 55, 56, 58, 60, 66, 70, 71, 78, 82], "pmsl": 67, "pn": [18, 39], "png": [8, 18, 39, 48, 50, 72, 73, 80], "png_catalog": 18, "po4": 44, "poc_flux_100m": 44, "pod": 44, "point": [1, 8, 11, 12, 15, 17, 23, 24, 25, 29, 30, 31, 32, 36, 42, 43, 44, 46, 47, 50, 57, 61, 63, 67, 71, 74, 80, 81, 83, 86, 87], "pointer": [12, 13], "pointinterp_method": 86, "pointlong_nam": 86, "pointstandard_nam": 46, "pointsunit": 86, "polit": 87, "polyfit_coeffici": 73, "polygon": 83, "polynomi": 73, "pop": [7, 8, 18, 20, 24, 28, 39, 43, 47, 61], "pop2": [28, 39, 61, 68, 92], "pop_grid": 61, "pop_gx1v7": 47, "pop_item": 46, "pop_tool": [43, 47, 61], "popitem": 46, "popular": [8, 15, 63, 64], "port": [22, 24, 38, 43, 52, 68, 84, 87], "portabl": 31, "portal": [8, 32, 88], "portion": [8, 22, 42, 47, 63, 84], "posit": [30, 38, 46, 61, 84], "posix": 84, "posixpath": [20, 28], "possibl": [1, 7, 24, 45, 53, 57, 67, 73, 80, 86, 87], "post": [0, 1, 6, 7, 11, 17, 25, 28, 29, 39, 40, 42, 43, 44, 45, 47, 50, 51, 52, 61, 63, 65, 67, 68, 71, 73, 75, 76, 77, 81, 83, 84, 88, 91], "postag": 15, "postdoc": 63, "poster": 8, "postprocess": 24, "potato": 80, "potenti": [2, 7, 28, 29, 37, 39, 42, 61, 68, 79, 80, 86], "power": [8, 23, 25, 28, 32, 37, 39, 43, 57, 83, 86], "pr": [0, 6], "practic": [2, 6, 7, 8, 10, 12, 13, 14, 29, 45, 64, 74, 76, 86, 87], "pre": [0, 8, 37, 41, 44, 61, 65, 67, 72, 83, 86], "prec": 87, "preced": [13, 90], "precip": 63, "precipit": 87, "precis": 81, "precl_07_climo": 41, "prect": 87, "predict": [30, 31], "prefer": [1, 7, 11, 12, 29, 57, 75], "prefix": 17, "preliminari": 80, "prem": 91, "prep": 75, "prepar": [6, 8, 77, 88, 90], "prepend": 45, "prepocess": 25, "preprint": 25, "preprocess": [8, 23, 31, 32, 61, 63, 65, 67], "prerequisit": 59, "presenc": [8, 89], "present": [6, 7, 8, 24, 25, 59, 62, 63, 73, 78, 80, 89, 90], "presentdai": 47, "preserv": [80, 90], "pressur": [37, 48, 67], "pressurearrai": 41, "pressurestagg": 67, "pressureunit": [46, 72, 83, 84], "pretti": [11, 61, 73, 84], "prev_avg_period": 81, "prevent": [29, 37, 61], "preview": [1, 68], "previou": [6, 8, 13, 14, 18, 19, 20, 25, 26, 27, 29, 35, 39, 41, 46, 49, 50, 52, 54, 57, 61, 68, 73, 75, 79, 80, 84, 88], "previous": [28, 32, 39, 47, 57, 67, 68, 84], "primari": [2, 6, 8, 23, 44, 59, 63, 72, 80, 86], "primarili": [2, 8, 40, 44, 49, 63, 67], "primit": 68, "principl": [2, 23], "print": [8, 13, 15, 17, 18, 20, 23, 37, 39, 43, 44, 67, 68, 72, 80, 83, 84, 86], "prior": [8, 15, 40, 73, 85, 87, 89], "priorit": 63, "prison": 15, "privat": [6, 63], "pro": [8, 12, 22], "proactiv": 2, "probabl": [73, 83], "problem": [2, 8, 10, 11, 14, 17, 24, 42, 63, 73, 75, 80, 86], "problemat": [25, 42, 73], "proc": [7, 20, 72], "proce": [39, 73], "proceed": [8, 89], "process": [7, 8, 17, 22, 23, 29, 30, 31, 32, 36, 38, 41, 43, 44, 46, 47, 52, 57, 61, 62, 67, 73, 74, 80, 81, 83, 84, 86, 87, 90], "processedkeyword": 61, "processor": [62, 74, 84, 86], "produc": [2, 12, 17, 23, 37, 53, 64, 67, 71, 83, 84, 92], "product": [2, 6, 7, 8, 17, 25, 50, 80, 83], "productionunit": 80, "profess": 78, "profession": 63, "profil": [47, 61, 63], "profit": 63, "profoundli": 2, "prognost": [28, 39, 61, 68], "program": [2, 7, 8, 10, 16, 24, 29, 40, 60, 63, 74, 78, 82], "progress": [6, 8, 30, 59, 62, 67], "progressbar": 20, "project": [2, 4, 7, 8, 11, 22, 23, 24, 25, 30, 37, 38, 40, 41, 42, 43, 44, 47, 50, 52, 63, 69, 70, 71, 75, 77, 78, 80, 81, 82, 83, 84, 86, 87, 90], "project_id": [22, 43, 52], "project_numb": 47, "projectid": 61, "projectprocessing_level": 61, "projectpythia": 59, "projectpythiatutori": [40, 70, 78], "promis": 25, "promot": [2, 6, 10, 25, 29], "prompt": [0, 12, 24, 45], "proof": 67, "propag": 83, "proper": [7, 68, 72], "properli": [8, 12, 39, 62, 67, 71, 73, 87], "properti": [63, 71], "propos": [6, 29, 67, 77, 85, 87, 88], "protocol": [63, 80, 86], "prototyp": [8, 10, 28, 30, 31, 32, 38, 44, 80], "prove": [8, 11], "proven": [2, 24], "provid": [2, 6, 7, 8, 10, 20, 23, 24, 25, 29, 30, 31, 36, 44, 48, 50, 52, 53, 59, 62, 64, 67, 68, 72, 73, 77, 80, 81, 83, 84, 86, 87, 88, 91, 92], "proxi": [22, 37, 38, 41, 43, 46, 52, 61, 62, 67, 68, 83, 84, 86, 87], "prun": 84, "prune": 45, "psarrai": [41, 72, 83, 84], "psd": 46, "pseudocod": [8, 87], "psfc": 67, "psl": [46, 51], "pslong_nam": [38, 46, 84], "psn012": 51, "psn012version": 23, "psu": 86, "pt": 23, "public": [7, 8, 37, 59, 61, 63, 64], "publicli": [8, 65, 89], "publish": [6, 8, 32, 50, 63, 64, 69, 89], "publish_dir": 44, "publisher_email": 61, "publisher_institut": 61, "pull": [0, 8, 19, 26, 27, 35, 39, 50, 63, 65, 81, 90], "puls": 80, "pump": [86, 87], "punctuat": 15, "pure": [14, 80], "purpos": [8, 10, 15, 17, 35, 38, 47, 71, 81, 83, 86, 88, 90], "pursu": [40, 80], "pursuit": [8, 88], "push": [0, 25, 29, 30, 35, 44, 63], "put": [4, 8, 15, 24, 39, 42, 45, 46, 47, 62, 64, 73, 74, 92], "puzzl": 74, "py": [8, 20, 28, 37, 38, 41, 44, 61, 67, 68, 69, 71, 80, 84, 87], "pyart": 63, "pydata": [39, 80, 83], "pypi": [28, 69], "pypii": 69, "pyplot": [37, 39, 41, 43, 47, 72, 73, 80, 81], "pyrom": 24, "pythia": [8, 29, 31, 32, 40, 65, 70, 75, 78, 82, 84, 86], "python": [1, 4, 6, 7, 8, 10, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 33, 34, 35, 39, 40, 44, 45, 48, 49, 50, 53, 54, 55, 56, 58, 59, 63, 66, 67, 70, 75, 76, 77, 78, 84, 85, 86, 88, 89, 90, 91], "python3": [15, 28, 37, 38, 41, 44, 61, 67, 68, 71, 80, 84, 87], "python_tutori": 12, "pyton": 60, "pyviz": 20, "q": [8, 12, 13, 14, 45, 48, 53, 69, 77, 86], "q_pbuh7n": 86, "qc": 63, "qqqqqqqaqd9vvvvvvubaqaaaaaaaaebavvvvvvvaqecqqqqqqqbaqqaaaaaaaebbvvvvvvvaqegqqqqqqqbaqgaaaaaaaebcvvvvvvvaqekqqqqqqqbaqwaaaaaaaebdvvvvvvvaqeoqqqqqqqbaraaaaaaaaebevvvvvvvaqesqqqqqqqbarqaaaaaaaebfvvvvvvvaqewqqqqqqqbargaaaaaaaebgvvvvvvvaqeaqqqqqqqbarwaaaaaaaebhvvvvvvvaqeeqqqqqqqbasaaaaaaaaebivvvvvvvaqeiqqqqqqqbasqaaaaaaaebjvvvvvvvaqemqqqqqqqbasgaaaaaaaebkvvvvvvvaqeqqqqqqqqbaswaaaaaaaeblvvvvvvvaqeuqqqqqqqbataaaaaaaaebmvvvvvvvaqeyqqqqqqqbatqaaaaaaaebnvvvvvvvaqe2qqqqqqqbatgaaaaaaaebovvvvvvvaqe6qqqqqqqbatwaaaaaaaebpvvvvvvvaq": 86, "qqqqqqqbauaaaaaaaaebqkqqqqqqgqfbvvvvvvvbauiaaaaaaaebqqqqqqqqgqfdvvvvvvvbauqaaaaaaaebrkqqqqqqgqffvvvvvvvbauyaaaaaaaebrqqqqqqqgqfhvvvvvvvbaugaaaaaaaebskqqqqqqg": 86, "qqqqqqrdax4aaaaaaambfvvvvvvvgwf8qqqqqqrdaxwaaaaaaambe1vvvvvvgwf6qqqqqqrdaxoaaaaaaambevvvvvvvgwf4qqqqqqrdaxgaaaaaaambd1vvvvvvgwf2qqqqqqrdaxyaaaaaaambdvvvvvvvgwf0qqqqqqrdaxqaaaaaaambc1vvvvvvgwfyqqqqqqrdaxiaaaaaaambcvvvvvvvgwfwqqqqqqrdaxaaaaaaaambb1vvvvvvgwfuqqqqqqrdaw4aaaaaaambbvvvvvvvgwfsqqqqqqrdawwaaaaaaamba1vvvvvvgwfqqqqqqqrdawoaaaaaaambavvvvvvvgwfoqqqqqqrdawgaaaaaaambz1vvvvvvgwfmqqqqqqrdawyaaaaaaambzvvvvvvvgwfkqqqqqqrdawqaaaaaaamby1vvvvvvgwfiqqqqqqrdawiaaaaaaambyvvvvvvvgwfgqqqqqqrdawaaaaaaaambx1vvvvvvgwfeqqqqqqrdav4aaaaaaambxvvvvvvvgwfcqqqqqqrdavwaaaaaaambw1vvvvvvgwfaqqqqqqrdavoaaaaaaambwvvvvvvvgwfyqqqqqqrdavgaaaaaaambv1vvvvvvgwfwqqqqqqrdavyaaaaaaambvvvvvvvvgwfuqqqqqqrdavqaaaaaaambu1vvvvvvgwfsqqqqqqrdaviaaaaaaambuvvvvvvvgwfqqqqqqqrdavaaaaaaaambt1vvvvvvgwfoqqqqqqrdau4aaaaaaambtvvvvvvvgwfmqqqqqqrdauwaaaaaaambs1vvvvvvgwfkqqqqqqrdauoaaaaaaambsvvvvvvvgwfiqqqqqqrdaugaaaaaaambr1vvvvvvgwfgqqqqqqrdauyaaaaaaambrvvvvvvvgwfeqqqqqqrdauqaaaaaaambq1vvvvvvgwfcqqqqqqrdauiaaaaaaambqvvvvvvvgwfaqqqqqqrdauaaaaaaaambpqqqqqqrawe9vvvvvvwdatwaaaaaaamboqqqqqqrawe5vvvvvvwdatgaaaaaaambnqqqqqqrawe1vvvvvvwdatqaaaaaaambmqqqqqqrawexvvvvvvwdataaaaaaaamblqqqqqqrawetvvvvvvwdaswaaaaaaambkqqqqqqrawepvvvvvvwdasgaaaaaaambjqqqqqqrawelvvvvvvwdasqaaaaaaambiqqqqqqrawehvvvvvvwdasaaaaaaaambhqqqqqqrawedvvvvvvwdarwaaaaaaambgqqqqqqrawezvvvvvvwdargaaaaaaambfqqqqqqrawevvvvvvvwdarqaaaaaaambeqqqqqqrawervvvvvvwdaraaaaaaaambdqqqqqqrawenvvvvvvwdaqwaaaaaaambcqqqqqqrawejvvvvvvwdaqgaaaaaaambbqqqqqqrawefvvvvvvwdaqqaaaaaaambaqqqqqqrawebvvvvvvwdaqaaaaaaaama": 86, "qssg0k7_": 41, "qstat": 7, "qsv6hesl": 41, "quadmesh": [38, 39, 41, 61, 67, 68, 80], "quadrilater": 68, "qualiti": [4, 6, 63], "quantifi": 63, "quantiti": [38, 44], "quarter": 81, "quartil": 63, "queri": [7, 28, 31, 42, 43, 46], "question": [6, 8, 10, 12, 13, 14, 23, 24, 25, 45, 48, 53, 62, 63, 64, 69, 72, 75, 76, 77, 79, 90], "queue": [7, 22, 43, 52, 87], "quick": [7, 20, 28, 29, 68, 90], "quickli": [8, 12, 23, 28, 46, 81, 88], "quickstart": 28, "quit": [8, 15, 23, 25, 39, 50, 61, 86, 87, 90], "quot": 17, "quotat": 45, "r": [38, 44, 45, 61, 63, 71], "r1002rbrxaaa01a": 17, "r1002rbrxaaa01aoutput_frequ": 17, "r10i1181p1f1": [46, 68], "r10i1231p1f1": [46, 68], "r10i1251p1f1": [46, 68], "r10i1281p1f1": [46, 68], "r10i1301p1f1": [46, 68], "r11i1231p1f2": 46, "r11i1281p1f2": 46, "r11i1301p1f2": 46, "r12i1231p1f2": 46, "r12i1281p1f2": 46, "r12i1301p1f2": 46, "r13i1231p1f2": 46, "r13i1251p1f2": 46, "r13i1281p1f2": 46, "r13i1301p1f2": 46, "r14i1231p1f2": 46, "r14i1251p1f2": 46, "r14i1281p1f2": 46, "r14i1301p1f2": 46, "r15i1231p1f2": 46, "r15i1251p1f2": 46, "r15i1281p1f2": 46, "r15i1301p1f2": 46, "r16i1231p1f2": 46, "r16i1281p1f2": 46, "r16i1301p1f2": 46, "r17i1231p1f2": 46, "r17i1281p1f2": 46, "r18i1231p1f2": 46, "r18i1251p1f2": 46, "r18i1281p1f2": 46, "r18i1301p1f2": 46, "r19i1231p1f2": 46, "r19i1251p1f2": 46, "r19i1281p1f2": 46, "r19i1301p1f2": 46, "r1i1001p1f1": [41, 46], "r1i1231p1f1": 46, "r1i1251p1f1": 46, "r1i1281p1f1": 46, "r1i1301p1f1": 46, "r20i1231p1f2": 46, "r20i1251p1f2": 46, "r20i1281p1f2": 46, "r20i1301p1f2": 46, "r2i1231p1f1": 46, "r2i1251p1f1": 46, "r2i1281p1f1": 46, "r2i1301p1f1": 46, "r3i1041p1f1": 46, "r3i1231p1f1": 46, "r3i1251p1f1": 46, "r3i1281p1f1": 46, "r3i1301p1f1": 46, "r4i1061p1f1": 46, "r4i1231p1f1": 46, "r4i1251p1f1": 46, "r4i1281p1f1": 46, "r4i1301p1f1": 46, "r5i1081p1f1": 46, "r5i1231p1f1": 46, "r5i1251p1f1": 46, "r5i1281p1f1": 46, "r5i1301p1f1": 46, "r6i1101p1f1": 46, "r6i1231p1f1": 46, "r6i1251p1f1": 46, "r6i1281p1f1": 46, "r6i1301p1f1": 46, "r7i1121p1f1": 46, "r7i1231p1f1": 46, "r7i1251p1f1": 46, "r7i1281p1f1": 46, "r7i1301p1f1": 46, "r8i1141p1f1": 46, "r8i1231p1f1": 46, "r8i1251p1f1": 46, "r8i1281p1f1": 46, "r8i1301p1f1": 46, "r9i1161p1f1": 46, "r9i1231p1f1": 46, "r9i1251p1f1": 46, "r9i1281p1f1": 46, "r9i1301p1f1": 46, "rabernat": 73, "racm": 17, "radar": [40, 72], "radi": [37, 41, 83], "radian": [72, 83], "radianc": 63, "radiat": 63, "radiomet": 63, "radiu": [61, 63], "raijin": [30, 90, 92], "raina": 65, "raina24": 65, "rais": [6, 7, 8, 23, 80, 84], "rajeev": 91, "ral": 2, "ram": 84, "rambl": [8, 15], "ran": [8, 42], "random": 73, "random_sampl": 73, "rang": [13, 20, 38, 41, 47, 53, 61, 63, 67, 68, 73, 81, 84, 86, 87], "rank": 10, "rankdir": [36, 50, 73], "rapese": 80, "rapid": 10, "rasm": [17, 71], "raster": [23, 38, 39, 41, 61, 67, 68], "rate": [2, 87], "rather": [23, 29, 43, 46, 47, 53, 67, 74], "ratio": [72, 83, 84], "ratio0": [80, 83], "ratio1": 80, "ravel": 80, "ravi": 25, "raw": [8, 18, 23, 36, 38, 45, 46, 50, 70], "raw_index": 25, "rb": [84, 86], "rcp": 38, "rcp8": 43, "rcp85": [36, 38, 43], "rcp85intake_esm_attr": 38, "rcparam": [68, 80], "rd": 23, "rda": [29, 81], "re": [7, 8, 12, 13, 14, 31, 45, 47, 74, 88], "reach": [8, 16, 62, 74, 75, 79, 88], "read": [8, 10, 12, 13, 15, 16, 17, 25, 29, 31, 32, 44, 47, 62, 63, 65, 78, 80, 82], "read_csv": 18, "read_xesmf_weights_fil": 83, "readabl": 65, "reader": 63, "readi": [0, 2, 6, 17, 40, 41, 49, 51, 71, 90], "readlin": [12, 13], "readm": [8, 33, 34, 50, 64, 75], "reagan": 61, "real": [25, 29, 80], "realist": 24, "realiti": 10, "realiz": [8, 15], "realli": [7, 8, 15, 25, 38, 63, 71, 73, 74, 80, 81, 87], "realm": 24, "reason": [14, 43, 44, 80, 86, 87], "recal": 80, "recap": [8, 83], "receiv": [8, 40, 45, 64, 73, 79, 80, 85, 88], "recent": [2, 7, 15, 25, 28, 32, 52, 62, 80], "rechunk": [73, 87], "recip": [30, 31, 61], "recipi": 15, "recipient_address": 15, "recipient_compani": 15, "recipient_nam": 15, "recipient_titl": 15, "recogn": [2, 8, 29, 45, 80, 81], "recognit": [8, 64], "recommend": [6, 7, 12, 14, 35, 43, 62, 64, 87], "recomput": 61, "record": [8, 21, 33, 49, 53, 54, 55, 63, 77, 89, 91], "recreat": 7, "rectilinear": 72, "recurs": 28, "red": [46, 47, 65, 68], "red_white_blu": 61, "redo": [83, 90], "reduc": [7, 8, 37, 43, 61, 63, 68, 80, 84], "reduct": 23, "ref": 86, "refactor": [8, 69, 74], "refer": [6, 7, 13, 14, 23, 37, 41, 46, 59, 61, 72, 74, 83], "referec": 86, "referenc": 14, "reference_case_nam": 44, "reference_fil": 84, "refin": [2, 8, 72, 88], "reflect": [8, 61, 74, 88], "refocu": [8, 88], "refresh": 7, "refress": 34, "refs_stat": 86, "regard": [8, 23, 24, 39, 51, 67, 90], "regardless": [8, 15], "region": [24, 43, 63, 67], "regist": [8, 38, 77, 85], "registr": [8, 77, 85], "regress": 73, "regrid": [8, 23, 32, 90], "regrid_cam_s": [72, 83], "regrid_method": [61, 72], "regridd": 61, "regridded_observ": 61, "regular": [6, 14, 28, 46, 71, 83, 84, 86, 88], "regulartitl": 86, "reimagin": [8, 32], "reinstal": [30, 75], "reinvent": 29, "rel": [8, 11, 20, 28, 67, 68, 80], "relabel": 39, "relampago": 40, "relat": [1, 2, 6, 7, 8, 19, 24, 25, 29, 32, 39, 41, 52, 59, 63, 65, 67, 79, 83, 90, 92], "relationship": 23, "relav": [8, 24], "releas": [8, 28, 38, 64, 68, 84, 87], "relev": [2, 6, 7, 8, 17, 28], "relhum": 41, "reli": 6, "relianc": 63, "remain": [2, 20, 28], "remap": [24, 72, 80, 90], "remap_cams": 83, "remapped_flat": 83, "remappingesmf_regrid_method": [72, 83], "remark": [8, 10], "rememb": [11, 20, 63, 74, 84], "remind": [8, 11, 72], "remot": [0, 8, 16, 18, 23, 25, 35, 46, 84], "remote_opt": 84, "remote_protocol": 84, "remov": [15, 45, 48, 61, 63, 72, 73, 74, 81, 83, 84, 87, 88], "rempl": 76, "renam": [46, 61, 67, 72, 83, 84, 86], "rend": [8, 39], "render": [2, 15, 18, 23, 39, 44, 50], "repeat": [11, 16, 80, 86, 90], "replac": [5, 7, 12, 15, 40, 44, 52, 57, 61, 83, 87], "replic": [8, 10, 46, 73, 92], "repo": [0, 8, 18, 32, 50, 63], "repo_root_directori": 44, "report": [20, 83], "repositori": [0, 1, 7, 8, 12, 18, 19, 21, 25, 26, 27, 28, 29, 30, 31, 33, 34, 35, 40, 43, 44, 49, 55, 56, 58, 61, 66, 70, 75, 78, 83], "repository_nam": 50, "repr": [17, 72, 73], "repres": [1, 6, 15, 37, 61, 62, 80, 81, 83, 84, 86], "represent": [23, 80, 84, 86], "reproduc": [2, 6, 8, 10, 25, 29, 46, 61, 75], "reproduct": [8, 31], "reqard": [8, 82], "request": [0, 7, 8, 35, 61, 72, 86, 87, 90], "requir": [2, 7, 8, 20, 22, 23, 25, 28, 29, 36, 38, 44, 46, 50, 59, 61, 64, 67, 71, 72, 73, 80, 81], "resampl": [46, 68, 81], "research": [2, 4, 6, 7, 8, 23, 29, 30, 31, 37, 40, 41, 56, 59, 63, 67, 79, 88, 92], "reset_coord": 47, "reshap": [72, 73], "residu": 41, "resili": [62, 63], "resolut": [8, 23, 24, 32, 37, 39, 41, 48, 72, 81, 83], "resolv": [8, 23, 61, 75], "resort": 40, "resourc": [8, 10, 20, 22, 25, 29, 37, 42, 43, 45, 52, 61, 62, 63, 74, 78, 82, 84, 86, 87, 89, 90, 92], "resource_spec": [22, 43, 46, 52, 87], "respect": [2, 7, 32, 39, 44, 80, 84], "respond": 86, "respons": 61, "respositori": 28, "rest": [8, 10, 20, 24, 28, 67, 80, 88], "restart": [28, 45, 62], "restoa": 41, "restor": 83, "restratifi": 86, "restrict": 71, "result": [0, 8, 15, 17, 25, 28, 41, 43, 44, 51, 68, 71, 74, 80, 81, 87], "rethink": 63, "retri": [7, 84], "retriev": [11, 13, 35, 63], "return": [2, 8, 11, 12, 13, 14, 17, 20, 22, 23, 28, 38, 39, 41, 42, 43, 44, 46, 47, 51, 61, 65, 67, 68, 71, 72, 73, 74, 80, 83, 86, 87], "return_invers": 80, "reus": [71, 72, 83, 86], "reusabl": 2, "reuse_weight": [72, 83], "review": [0, 19, 33, 35, 75], "revis": [28, 39, 61, 68], "revision_id": [23, 51, 72, 83], "revolutionari": [8, 23], "rewritten": 73, "rh": [65, 67], "rho": 47, "rho_chunk": 47, "rho_in": 47, "rho_stack": 47, "rice": 80, "right": [0, 1, 7, 12, 14, 18, 20, 23, 36, 48, 50, 59, 68, 71, 72, 74, 80, 81, 83, 87, 88], "righttitl": 81, "righttitlefonts": 81, "risk": 63, "road": [28, 63], "roadblock": 74, "rob": 25, "robinson": [23, 41], "robust": [39, 80, 83], "rocki": [8, 65], "rodger": [8, 37], "rof": 28, "role": 63, "roll": [73, 74], "rom": 24, "romashkov": 2, "romashkova": [76, 77, 89], "romatschk": 2, "room": [8, 16, 24, 75, 77, 85, 90], "root": [8, 28, 44, 50, 74, 86], "root_path": [17, 20, 28], "rotat": 67, "roughli": [8, 61, 85], "roundabout": 73, "routin": 15, "row": [13, 18, 20, 28, 36, 41, 46, 62, 72, 83, 84], "rse": 63, "rubber": 74, "rubi": 29, "rule": [7, 13, 87], "run": [5, 6, 7, 8, 12, 15, 17, 19, 20, 22, 24, 26, 27, 28, 29, 30, 33, 34, 37, 38, 39, 43, 44, 45, 46, 48, 50, 53, 55, 59, 62, 68, 69, 73, 75, 80, 83, 84, 86, 87, 92], "runtimewarn": [11, 84], "rust": 25, "rw": 71, "ryan": [2, 32, 40, 89], "rye": 80, "s0_control": 80, "s19": 67, "s3": [8, 36, 46, 63, 68], "s3f": 84, "s3filesystem": 84, "s40": 80, "s40b": 80, "s8": [72, 83], "s8dask": [72, 83], "sadli": 73, "safe": 72, "safe_load": 44, "safest": 53, "sai": [7, 12, 13, 14, 88], "said": 15, "sake": 15, "salin": [39, 47], "salinitystandard_nam": 86, "salinityunit": 39, "salt": [36, 39, 44, 47], "same": [7, 8, 11, 12, 13, 14, 15, 17, 19, 23, 24, 26, 27, 38, 39, 46, 51, 52, 53, 57, 59, 63, 65, 68, 69, 71, 72, 79, 80, 86, 87, 90], "samp_sec": 65, "sampl": [8, 16, 28, 43, 65, 67, 71, 92], "sand": 67, "sandfrac": 67, "saniti": 24, "sat": [23, 87], "satellit": [25, 40], "satisfi": 80, "save": [6, 7, 12, 13, 17, 44, 45, 48, 57, 61, 71, 80, 88], "save_mfdataset": 7, "savefig": 48, "scalabl": [2, 20, 24, 25, 29], "scale": [2, 7, 8, 10, 20, 22, 23, 29, 32, 37, 38, 39, 41, 43, 46, 47, 52, 61, 63, 67, 68, 84, 87, 90, 91], "scam": 15, "scan": 63, "scare": 15, "scatter": [46, 65, 72], "scb_dom": 67, "scell_method": [80, 87], "scenario": [11, 15, 46], "schedul": [7, 8, 16, 17, 25, 31, 32, 37, 38, 41, 43, 46, 52, 61, 62, 67, 68, 73, 77, 79, 83, 84, 86, 87, 88], "scheick": 89, "scheme": 87, "schneck": 91, "school": 40, "scienc": [2, 3, 4, 6, 7, 10, 11, 23, 24, 25, 29, 40, 63, 73, 82, 88, 90, 91], "scientif": [2, 6, 7, 8, 10, 23, 24, 25, 29, 32, 50, 59, 62, 63, 81, 88, 90], "scientist": [2, 8, 10, 11, 16, 23, 29, 56, 59, 64, 70, 74, 79, 82, 88, 90], "scipi": [8, 23, 24, 32, 47, 51, 83], "scipy_kdtre": 51, "scope": [14, 25], "scott": [89, 91], "scratch": [4, 7, 10, 20, 23, 37, 38, 41, 43, 44, 67, 72, 80, 86, 87], "screen": [0, 12, 57], "screenshot": [44, 71, 73], "script": [7, 8, 12, 14, 15, 16, 22, 44, 82, 83, 92], "scroll": [23, 37, 59, 88], "sct_dom": 67, "se": [8, 51, 72, 90], "se_grid": 72, "sea": [37, 42, 48, 63, 67, 81, 86], "sea_floor_depth_below_geoid": 86, "sea_floor_depth_below_geoidunit": 86, "sea_surface_salinitytime_avg_info": 86, "sea_surface_temperatur": 81, "sea_surface_temperaturecell_method": 81, "sea_surface_temperaturetime_avg_info": 86, "sea_water_potential_temperaturetime_avg_info": 86, "sea_water_salinitytime_avg_info": 86, "sea_water_temp": 61, "sea_water_temperatur": 61, "sea_water_temperaturelong_nam": 61, "sea_water_x_velocitytime_avg_info": 86, "sea_water_y_velocitytime_avg_info": 86, "seaic": 67, "seam": 63, "seamless": [23, 39, 90], "search": [8, 15, 25, 28, 31, 36, 37, 38, 39, 41, 42, 46, 61, 73], "searchabl": 69, "season": [8, 16, 92], "seasonal_average_weighted_correctli": 81, "seasonal_average_weighted_incorrectli": 81, "seasonal_obs_d": 41, "seasonal_obs_plot": 41, "seasonpandasindexpandasindex": 81, "second": [8, 12, 13, 15, 23, 25, 30, 37, 47, 50, 65, 67, 72, 76, 80, 83, 84, 87, 90], "second_cas": 39, "second_plot": 39, "secret": 44, "section": [7, 8, 12, 13, 14, 20, 23, 30, 37, 40, 44, 59, 61, 63, 75, 76, 77, 80, 88], "secur": 79, "see": [0, 6, 7, 8, 10, 12, 13, 14, 15, 17, 20, 22, 25, 28, 29, 36, 37, 39, 41, 43, 44, 45, 46, 50, 51, 52, 57, 59, 62, 63, 67, 68, 69, 70, 71, 73, 74, 75, 77, 78, 80, 81, 83, 84, 85, 86, 87, 88, 89, 90], "seek": [2, 6, 78], "seem": [8, 39, 45, 51, 73, 83], "seemingli": 68, "seen": [38, 39, 63], "sehires38": [23, 51, 72], "seidov": 61, "seismic": 39, "sel": [7, 11, 37, 39, 46, 51, 61, 68, 80], "sel_drop": 30, "select": [6, 7, 8, 17, 22, 38, 41, 43, 46, 50, 51, 52, 57, 59, 71, 75, 79, 87, 88], "self": [20, 37, 41, 57, 67, 90], "selvar": 87, "selyear": 87, "semar": 16, "seminar": [8, 12, 13, 14, 19, 21, 26, 27, 33, 34, 35, 40, 45, 48, 49, 53, 54, 55, 56, 58, 66, 69, 70, 75, 77, 78, 85], "send": [6, 15, 28, 62], "sens": [8, 15, 23, 25, 31, 59, 88], "sensit": 13, "sent": 61, "sep": [20, 28, 39, 41, 61], "separ": [6, 14, 16, 41, 42, 46, 59, 86], "seper": [8, 69], "septemb": [8, 33, 34], "sequenc": 87, "sequenti": 80, "seri": [7, 8, 11, 12, 13, 14, 18, 19, 20, 21, 23, 26, 27, 28, 32, 33, 34, 35, 40, 45, 46, 48, 49, 53, 54, 55, 56, 58, 63, 66, 69, 70, 73, 78, 87, 91, 92], "serial": [7, 17, 25, 35, 71], "seriou": [15, 73], "serious": 11, "serv": [2, 4, 6, 8, 10, 24, 36, 64, 76, 78, 88], "servabl": 18, "server": [1, 7, 8, 18, 37, 38, 65, 68, 84, 87], "servic": [6, 8, 15, 45, 57, 63, 75, 79, 88, 91], "session": [8, 12, 13, 14, 16, 19, 21, 24, 26, 27, 34, 35, 40, 45, 48, 49, 53, 54, 55, 57, 58, 63, 66, 69, 76, 77, 82, 86, 90, 91], "set": [0, 2, 4, 6, 8, 12, 13, 15, 16, 20, 22, 23, 24, 28, 29, 31, 37, 38, 39, 41, 42, 47, 48, 51, 52, 57, 61, 62, 63, 67, 68, 74, 75, 77, 79, 80, 81, 84, 88], "set_axes_limits_and_tick": 81, "set_coord": 51, "set_index": 51, "set_opt": [39, 80], "set_tick": 81, "set_titles_and_label": 81, "set_xlim": 48, "setiawan": 89, "setlevel": 46, "setup": [7, 8, 12, 22, 28, 29, 37, 39, 42, 43, 44, 47, 50, 51, 62, 68, 71, 77], "setup_ax": 80, "sever": [2, 6, 7, 8, 11, 25, 36, 41, 59, 61, 92], "sewg": [8, 24], "sf": [23, 87], "sfcgroup": 86, "sfwf": 44, "sgyeager": [8, 42], "sh": 87, "shade": [62, 68], "shallowest": 80, "shape": [17, 30, 38, 39, 41, 46, 61, 63, 67, 68, 72, 73, 80, 83, 84, 86, 87], "shapew": 83, "sharabl": 61, "share": [2, 6, 8, 11, 12, 20, 24, 25, 28, 38, 44, 46, 48, 50, 63, 74, 76, 84, 87, 88, 89, 90, 91], "shareabl": 24, "she": [15, 67, 82], "sheet": 7, "shell": [12, 87], "shell_nam": 12, "shf": 44, "shf_qsw": 44, "shield": [64, 72], "shift": [8, 10], "shini": [8, 74], "ship": [59, 63], "shirt": 40, "shoot": [45, 77], "shop": [8, 10, 76], "short": [8, 13, 15, 63], "shortcom": 38, "shortcut": 57, "shorten": 22, "shortwav": 41, "shortwavearrai": 41, "shortwavelunit": 41, "should": [0, 7, 8, 12, 14, 15, 20, 22, 24, 25, 28, 29, 39, 41, 42, 43, 44, 45, 47, 50, 61, 68, 69, 72, 74, 80, 83, 87, 88], "shoutout": 52, "show": [7, 8, 10, 18, 25, 37, 41, 44, 46, 62, 65, 67, 72, 73, 79, 81, 87, 88], "showcas": [6, 8, 71], "shown": [8, 37, 42, 44, 46, 62, 65, 67, 81], "shrink": [25, 80, 81], "shum": 41, "shut": [8, 45, 74], "shutdown": 45, "shutil": 43, "side": [12, 39, 57, 59, 63, 71, 90], "sidebar": [59, 71], "sig": 6, "sigma": [47, 86], "sign": 6, "signatur": [17, 28, 80], "signific": [8, 80, 84, 90], "significantli": 2, "silenc": [46, 67, 84], "silin": 42, "silo": [25, 63], "silver": [8, 74], "similar": [8, 11, 20, 25, 44, 46, 61, 67, 68, 74, 83, 84, 88], "simpl": [8, 10, 15, 23, 25, 29, 37, 38, 63, 70, 73, 74, 80, 81, 82], "simplehttpserv": 1, "simpler": 80, "simplest": 74, "simpli": [11, 29, 61, 62, 87], "simplic": 23, "simplifi": [61, 62], "simul": [6, 25, 39, 47, 67, 72, 83, 86], "simulation_start_d": 67, "simultan": 17, "sin": [17, 73], "sin_rot": 86, "sinalpha": 67, "sinalpha_u": 67, "sinalpha_v": 67, "sinc": [7, 8, 11, 13, 15, 17, 18, 23, 28, 32, 35, 37, 38, 39, 41, 42, 43, 46, 57, 61, 62, 64, 65, 66, 67, 68, 69, 72, 73, 79, 80, 81, 83, 86, 88, 90], "sincer": 15, "sine": [67, 86], "singl": [7, 8, 12, 13, 18, 20, 24, 28, 29, 39, 41, 42, 45, 47, 59, 61, 63, 65, 67, 68, 71, 72, 73, 83, 84, 90, 91], "singlehdf5tozarr": 84, "sintake_esm_attr": 38, "sio2_flux_100m": 44, "sio2_prod": 44, "sio3": [18, 44], "sio3_riv_flux": 28, "sioaa0mt": 41, "siparc": [8, 86], "siphon": 78, "sit": [8, 15, 25, 79, 90], "site": [7, 8, 28, 29, 37, 38, 41, 42, 45, 61, 65, 67, 68, 80, 84, 87], "situ": [61, 86], "situat": [8, 51, 65, 69], "six": 68, "sizabl": [8, 89], "size": [7, 8, 17, 23, 25, 30, 31, 37, 41, 43, 46, 47, 53, 63, 72, 73, 80, 81, 83, 84], "sizemor": [8, 21], "skew": 73, "skill": [2, 8, 88], "skintemp": 67, "skip": [7, 47, 83, 86, 87], "skip_instance_cach": [84, 86], "skipna": 73, "sky": [41, 63], "skyunit": 41, "slat": 46, "sleep": [8, 15], "slice": [11, 13, 17, 28, 37, 43, 46, 47, 61, 67, 68, 80], "slide": [8, 25, 89, 90, 91], "slider": 39, "slight": [32, 51], "slightli": [61, 80], "sloan": 63, "slon": 46, "slong_nam": 72, "slot": [6, 75], "slow": [25, 29, 74, 84, 87], "slowdown": 62, "slower": [31, 84], "slowli": [8, 10], "slurm": [8, 22, 43], "sm": 67, "sm000007": 67, "sm007028": 67, "sm028100": 67, "sm100289": 67, "small": [8, 10, 17, 24, 25, 63, 67, 73, 74, 77, 80, 81, 83, 85], "smaller": [7, 20, 28, 31, 47, 73, 84, 87], "smallest": [61, 80], "smart": 25, "smbb": [37, 46, 87], "smbb_plot": 46, "smith": 15, "smol_da": 73, "smolyar": 61, "smooth": [37, 46, 63], "smyle": [20, 32], "snail": 15, "snippet": [17, 71], "snoalb": 67, "snow": 67, "snowfrac": [20, 28], "snowh": 67, "snuff": 74, "so": [4, 6, 7, 8, 10, 11, 12, 13, 14, 15, 17, 19, 20, 21, 22, 25, 26, 27, 29, 32, 33, 34, 35, 39, 42, 43, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 63, 66, 68, 69, 70, 72, 73, 74, 78, 79, 80, 83, 84, 86, 87, 88, 90], "sobhani": [89, 91], "societ": 2, "societi": 63, "soft": 29, "softwar": [2, 8, 10, 11, 15, 25, 29, 32, 35, 40, 45, 56, 57, 63, 74, 77, 79, 82, 88, 90, 92], "soil": [67, 80], "soil_lay": 67, "soilcbot": 67, "soilctop": 67, "soilhgt": 67, "soiltemp": 67, "sol_tsi": [72, 83, 84], "solar": [36, 41, 63, 72, 83, 84], "sole": 15, "solid": 90, "solin": 41, "solut": [2, 6, 7, 8, 24, 30, 57, 73, 74, 80, 92], "solv": [2, 8, 10, 25, 28, 43, 60, 62, 72, 74], "some": [1, 6, 7, 8, 11, 12, 15, 16, 23, 24, 25, 29, 31, 32, 35, 37, 38, 39, 42, 43, 44, 47, 50, 61, 62, 63, 67, 68, 71, 72, 73, 74, 75, 76, 79, 80, 82, 83, 84, 86, 87, 88, 89, 90], "some_output_fil": 46, "some_vari": 30, "someberg": 15, "somehow": 45, "someon": [25, 74], "someth": [12, 15, 20, 22, 25, 29, 39, 45, 57, 63, 67, 69, 80], "somethingstagg": 67, "sometim": [11, 17, 24, 25, 73, 74, 87], "somewher": [15, 47, 74, 86], "son": [41, 81], "soon": [25, 28, 88], "sophist": 15, "sophstic": 38, "sorghum": 80, "sort": [8, 24, 29, 39, 41, 67, 84, 86, 87], "sound": 63, "sourc": [2, 6, 8, 10, 12, 17, 23, 25, 28, 38, 39, 41, 44, 46, 51, 56, 61, 64, 67, 68, 70, 72, 73, 78, 80, 84, 86, 87], "source_": 41, "source_id": 42, "south": [41, 67], "south_north": 67, "south_north_stag": 67, "southeast": 61, "southerli": 67, "southern": 40, "southstagg": 67, "southwest": 61, "sp": 83, "space": [6, 7, 13, 14, 20, 25, 29, 31, 37, 41, 45, 59, 63, 73, 80, 86, 87, 90], "spacer": 18, "span": [8, 11, 16, 46, 82, 87], "spanish": 15, "spare": 80, "spars": [8, 25], "sparse_array_data": 83, "sparse_data": 80, "sparse_gpp": 80, "sparse_gpp_da": 80, "sparse_map": 83, "sparse_matrix": 80, "spatial": [8, 20, 23, 25, 37, 41, 47, 63, 72, 87], "spatial_domain": [36, 38, 46], "spatio": 25, "spatiotempor": [8, 41], "speak": [74, 80, 86], "speaker": [8, 24, 25, 63, 91], "speci": 63, "special": [14, 38, 39, 68, 69], "specialgeospatial_vertical_posit": 61, "specialti": 79, "specif": [6, 8, 14, 16, 18, 23, 24, 25, 29, 30, 42, 43, 46, 47, 50, 51, 52, 57, 59, 60, 62, 63, 64, 69, 72, 82, 84, 86, 88, 91], "specifi": [7, 11, 14, 15, 20, 22, 23, 28, 37, 39, 41, 43, 44, 45, 47, 48, 50, 52, 61, 64, 65, 67, 68, 69, 80, 81, 84, 86, 87], "specifici": 7, "spectral": [8, 46, 72, 83, 90], "speed": [7, 8, 25, 38, 62, 65, 86], "speedtime_avg_info": 86, "spend": [2, 40], "spent": 62, "sphere": 72, "sphinx": 74, "spill": [62, 87], "spin": [8, 22, 25, 52, 62], "split": [11, 24, 37, 41, 63, 84], "split_by_chunk": 17, "split_large_chunk": [37, 67], "spot": 6, "spread": [46, 88], "spreadsheet": 6, "spring": [8, 40], "spring_wheat": 80, "sprint": 63, "spyder": 12, "sqrt": [17, 38], "squar": [13, 61, 72, 80, 83, 88], "squarespac": 88, "src": [18, 83], "src_grid_dim": [72, 83], "src_grid_rank": [72, 83], "srclat": 83, "srclon": 83, "ssh": [7, 21, 57, 58, 66, 86], "ssmi_09_climo": 41, "ssmi_seaice_djf_climo": 41, "ssp370": [37, 46, 68], "sss": 20, "sst": [20, 46, 63, 67, 81], "sst2": 20, "ssu": 86, "ssv": 86, "st": 67, "st000007": 67, "st007028": 67, "st028100": 67, "st100289": 67, "sta": [76, 77, 91], "stabl": [22, 37, 38, 41, 43, 46, 52, 61, 62, 67, 68, 83, 84, 86, 87], "stac": 25, "stack": [4, 7, 18, 23, 24, 29, 31, 39, 45, 47, 68, 73, 74, 80, 83], "stackplot": 39, "stackstac": 25, "staf": 32, "staff": [2, 6, 79, 91], "stage": [35, 87], "stagger": [25, 46, 67], "stai": 63, "stakehold": [2, 6], "stand": [28, 64, 67], "standard": [8, 11, 29, 40, 56, 61, 63, 67, 69, 70, 78, 84], "standard_deviationgrid_map": 61, "standard_errorlong_nam": 61, "standard_nam": [11, 46, 61, 81, 86, 87], "stanislaw": 77, "star": 77, "start": [0, 4, 8, 10, 12, 13, 14, 15, 16, 17, 20, 24, 25, 28, 29, 36, 37, 38, 39, 41, 42, 44, 46, 47, 50, 53, 57, 61, 63, 65, 67, 68, 71, 73, 74, 77, 80, 81, 82, 83, 84, 86, 90], "start_tim": [20, 36, 37, 38, 46, 61], "startbound": 46, "stash": [19, 26, 27], "stat": 63, "state": [6, 8, 24, 25, 28], "statement": [7, 13, 14], "stati": 46, "static": [2, 8, 23, 36, 39, 46, 50, 79, 87, 92], "static_ref": 86, "staticdict": 86, "staticfil": 86, "station": [8, 30], "statist": [25, 61, 81, 92], "statu": [12, 17, 22, 35, 37, 38, 41, 43, 45, 46, 52, 61, 67, 68, 73, 83, 84, 86, 87], "std": 83, "stem": [8, 41, 74], "step": [0, 2, 8, 11, 12, 13, 15, 17, 20, 21, 23, 28, 38, 42, 43, 44, 50, 52, 53, 57, 58, 61, 63, 65, 67, 73, 74, 80, 83], "stephan": 17, "sterzing": [8, 32, 86], "steve": [8, 23, 32, 42], "still": [8, 10, 14, 15, 25, 39, 40, 41, 42, 44, 45, 46, 47, 52, 56, 61, 68, 70, 73, 74, 78, 79, 80, 84, 88, 90, 92], "stop": [8, 12, 13, 15, 17, 32, 53, 74, 76], "storag": [4, 25, 63, 84, 86], "storage_opt": [18, 38, 46, 68], "store": [8, 13, 18, 22, 25, 28, 37, 38, 41, 46, 61, 62, 65, 68, 73, 80, 83, 84, 86], "str": [18, 28, 36, 41, 50, 72, 83], "straight": 73, "straightforward": 68, "strateg": 63, "strategi": [2, 30, 31, 44], "stream": [8, 20, 28, 37, 39, 41, 43, 50, 61, 62, 86], "streamlin": 83, "street": 15, "stress": [25, 67], "strftime": [15, 17, 41], "strict": 73, "strictli": [69, 86], "string": [8, 14, 15, 37, 53, 81, 83], "stringer": 2, "strive": 92, "structur": [2, 8, 16, 25, 44, 50, 62, 63, 82, 86], "struggl": [8, 11, 15, 24, 42, 62, 74], "stuck": 73, "student": 63, "studi": [40, 75], "studio": [8, 57], "stuff": 15, "sub": [73, 86], "subcolumnarrai": 72, "subfold": 86, "subgrid": 67, "subgroup": 90, "subject": 40, "submit": [28, 29, 31, 77, 85, 88], "suboptim": 73, "subplot": [37, 48, 65], "subplot_kw": 80, "subscript": 83, "subsequ": [60, 69], "subset": [7, 8, 20, 23, 31, 38, 42, 43, 47, 51, 67, 68, 80, 81, 84, 86, 88], "subset_d": 37, "subset_to_singleton": 47, "substanti": [20, 62, 80], "substit": 15, "substitut": [15, 44], "substr": 28, "subtl": [11, 68, 84], "subtract": [8, 46, 73, 80], "succeed": 74, "success": [6, 8, 10, 12, 25], "successfulli": 84, "sucsat": 80, "sudden": 73, "suddenli": [11, 73], "sudo": 12, "sugarbeet": 80, "sugarcan": 80, "suggeest": 29, "suggest": [6, 7, 12, 29, 31, 61], "suit": 71, "suitabl": [8, 22, 47], "sum": [46, 61, 68, 73, 86], "sumgrid_map": 61, "summ": 83, "summar": [8, 24, 81], "summari": [7, 8, 18, 30, 31, 59, 61], "summary_map": 18, "summer": [8, 40, 41], "summit": [8, 32], "sundai": 63, "sundown": [8, 12], "sunflow": 80, "sunseon": [84, 87], "sunseonhost": [84, 87], "sunseonmodel_doi_url": 84, "sunwai": 72, "sunway_02": [23, 51], "sunway_02titl": 23, "super": [67, 68], "supercomput": [8, 10], "supersed": 46, "suppli": [11, 53], "support": [2, 6, 8, 10, 11, 12, 23, 24, 25, 28, 29, 32, 40, 41, 48, 53, 63, 72, 73, 76, 78, 81, 83, 91, 92], "suppos": 74, "sure": [0, 8, 17, 21, 22, 24, 28, 29, 30, 31, 32, 37, 39, 42, 44, 45, 50, 57, 58, 62, 68, 74, 75, 81, 86, 87, 88], "surfac": [10, 17, 36, 37, 39, 46, 47, 61, 63, 65, 67, 68, 80, 81, 86], "surfacestatist": [46, 81], "surfacetitl": 46, "surfdata_0": 80, "surprisingli": 73, "survei": 90, "susan": 2, "suspici": 46, "sustain": [2, 63], "svg": [18, 48, 50], "swap_dim": 11, "swcf": 41, "switch": [0, 8, 16, 84, 88], "switchgrass": 80, "sy": [23, 46, 51, 67, 68, 72, 83, 84, 86], "sylvania": 15, "symbol": 14, "sync": [4, 71, 88], "synchron": 78, "syndrom": [8, 74], "syntax": [7, 13, 15, 36, 42, 43, 44, 50, 61, 65, 74], "synthes": [2, 44], "synthesi": 2, "system": [2, 3, 4, 6, 7, 12, 20, 23, 24, 28, 29, 30, 31, 36, 37, 40, 41, 42, 46, 52, 56, 62, 80, 84, 86, 88, 91], "szaunit": 72, "t": [7, 8, 10, 11, 12, 13, 14, 23, 25, 28, 29, 38, 39, 45, 46, 47, 50, 51, 52, 61, 63, 67, 68, 69, 72, 73, 74, 81, 84, 86, 87, 88, 90], "t_": 61, "t_an": 61, "t_cmip6": 46, "t_cmip6_mean": 46, "t_cmip6_t": 46, "t_cmip6_ts_df": 46, "t_dd": 61, "t_gp": 61, "t_ma": 61, "t_mn": 61, "t_oa": 61, "t_ref": 46, "t_ref_mean": 46, "t_ref_t": 46, "t_sd": 61, "t_se": 61, "t_smbb": 46, "t_smbb_mean": 46, "t_smbb_t": 46, "t_smbb_ts_df": 46, "tab": [7, 47], "tabl": [1, 8, 20, 28, 59, 61, 85, 86], "table_id": 42, "tag": [0, 44, 71], "tair": [17, 71], "take": [8, 11, 12, 14, 15, 17, 20, 25, 28, 29, 37, 39, 41, 43, 45, 46, 47, 50, 53, 59, 61, 62, 63, 67, 74, 80, 81, 84, 86, 87], "takeawai": [8, 32, 59, 91], "taken": 25, "talk": [6, 8, 11, 12, 15, 24, 30, 31, 62, 63], "tall": 10, "tarea": 43, "target": 2, "target_opt": 84, "tarrai": 87, "task": [8, 17, 20, 24, 28, 29, 31, 36, 38, 39, 41, 43, 44, 46, 47, 57, 61, 62, 67, 68, 73, 74, 80], "tavg": 61, "taysia": [8, 76, 85, 91], "tb": [8, 25, 29, 43, 46], "tba": [8, 34, 60], "tbd": 16, "tbodi": 18, "tbot": 37, "tbound": 81, "tc": [38, 83], "tclimatologi": 61, "tcoordinate_defin": 46, "tcp": [17, 37, 38, 41, 46, 61, 67, 68, 73, 83, 84, 86, 87], "tdry": 65, "teach": [8, 10, 15, 35, 56, 74], "teacher": [8, 15], "teagan": [2, 91], "team": [8, 10, 16, 17, 24, 25, 29, 30, 31, 33, 34, 40, 56, 59, 60, 62, 63, 64, 92], "tech": 63, "technic": [2, 6, 8, 16, 61, 90], "techniqu": [8, 19, 34, 60, 73], "technologi": [2, 6, 8, 10, 29], "tell": [12, 80, 83, 90], "temp": [17, 23, 28, 39, 43, 44, 47, 61, 68, 81], "temp_100m_mean": 43, "temp_depth": 47, "temp_sum": 68, "temperate_corn": 80, "temperate_soybean": 80, "temperatur": [7, 23, 37, 38, 39, 42, 43, 47, 61, 63, 67, 68, 81], "temperature_plot": 65, "temperaturecell_method": [23, 41, 84], "temperatureclimatologi": 41, "temperaturedataset": 81, "temperaturekeywords_vocabulari": 61, "temperaturelevel_desc": 46, "temperaturemdim": 84, "temperaturestagg": 67, "temperaturestandard_nam": 86, "temperaturetype_pref": 17, "temperatureunit": [39, 46, 61, 68], "temperatureunpacked_valid_rang": 81, "tempest": 24, "tempestremap": [83, 90], "templat": [8, 47, 50, 71], "tempor": [8, 20, 25, 32, 41, 42, 61, 63], "temporari": [7, 63], "tempout": 13, "tempt": [68, 81], "ten": 10, "tenant": 11, "tend": [69, 88], "tendenc": 37, "tension": 15, "tensordot": [8, 72, 73], "tent": 29, "tenth": 61, "terabyt": [46, 62, 87], "term": [20, 24, 25, 29, 32, 36, 38, 39, 42, 63, 87], "termin": [0, 7, 8, 19, 21, 26, 27, 30, 40, 45, 50, 55, 56, 57, 58, 66, 70, 78, 82], "terminologi": 86, "terrain": 67, "terrestri": [24, 80], "test": [8, 10, 17, 19, 21, 23, 25, 26, 27, 28, 38, 40, 41, 43, 46, 47, 53, 55, 58, 63, 66, 68, 70, 74, 78], "test_1x777602_768x1152_peri": 83, "test_history_fil": 20, "test_timeseries_fil": 20, "tester": 24, "text": [0, 12, 13, 15, 18, 50, 61, 63, 69], "tf": 23, "th": [18, 57, 72], "than": [8, 10, 15, 20, 25, 40, 45, 47, 53, 61, 63, 67, 68, 74, 81, 87, 88], "thank": [17, 73, 76, 91], "thead": 18, "thei": [2, 7, 8, 10, 11, 14, 15, 16, 20, 23, 25, 29, 39, 41, 46, 47, 48, 53, 57, 61, 62, 63, 69, 79, 81, 92], "them": [8, 12, 13, 15, 23, 25, 29, 61, 62, 65, 68, 69, 72, 78, 79, 80, 86, 87, 88], "themselv": [10, 37], "theori": [62, 83], "thetao": [42, 86], "thi": [0, 1, 2, 3, 4, 5, 6, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 48, 49, 50, 51, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 84, 85, 86, 87, 88, 89, 90, 91, 92], "thick": 86, "thicknesstime_avg_info": 86, "thing": [10, 12, 14, 15, 16, 25, 62, 63, 68, 73, 80, 81, 86, 88, 90], "think": [4, 8, 10, 11, 15, 28, 39, 43, 47, 48, 63, 74, 80, 86], "third": [8, 12, 14, 16, 36, 44], "thoma": [2, 89], "those": [2, 8, 12, 13, 14, 15, 20, 23, 24, 38, 39, 41, 42, 43, 44, 50, 63, 67, 73, 75, 80, 81, 83, 87, 90], "though": [8, 10, 15, 28, 29, 35, 41, 51, 62, 65, 69, 74, 88, 90], "thought": [17, 74], "thread": [7, 28, 37, 38, 41, 44, 46, 47, 61, 67, 68, 73, 80, 83, 84, 86, 87], "threads_per_work": 86, "threat": 63, "thredd": [46, 61], "three": [8, 13, 17, 18, 39, 50, 59, 63], "threshold": [47, 63], "through": [4, 6, 7, 8, 12, 13, 15, 16, 18, 29, 30, 32, 37, 47, 50, 62, 63, 64, 71, 72, 73, 74, 77, 82, 84, 85, 89, 90], "throughout": [7, 8, 12, 41, 59, 62, 74, 78, 86, 90], "thu": [2, 8, 32, 41, 59], "thumb": 7, "thumbnail": 18, "thurdai": [8, 82], "thursdai": [8, 75, 77, 85], "ti": 69, "tib": [46, 61], "tick": [81, 84], "tick_param": 81, "ticket": 7, "ticksiz": 37, "tiff": 86, "tild": 87, "time": [0, 2, 6, 8, 10, 12, 14, 15, 16, 17, 18, 22, 23, 24, 25, 26, 27, 28, 29, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 50, 51, 52, 53, 56, 57, 59, 62, 63, 64, 66, 68, 69, 70, 72, 73, 74, 77, 78, 79, 80, 81, 84, 86, 87, 88, 92], "time_bnd": [7, 23, 38, 46, 51, 72, 81, 83, 84, 86, 87], "time_bnds_varnam": 43, "time_bndsactual_rang": 46, "time_bndsarrai": [23, 41, 72, 81, 83, 84], "time_bndsaxi": 87, "time_bndscalendar_typ": 86, "time_bndslong_nam": [38, 46, 84], "time_bndsxarrai": 81, "time_bound": [7, 43, 68, 80], "time_bound_diff": 46, "time_boundarrai": 61, "time_boundlong_nam": 68, "time_bounds_dim_nam": 7, "time_boundsarrai": 80, "time_cent": 43, "time_constant_3dvar": 80, "time_constant_3dvars_filenam": 80, "time_dt": 11, "time_encod": 43, "time_offset": 65, "time_period": [18, 41], "time_period_freq": [28, 39, 61, 68, 80, 84, 87], "time_rang": [20, 37, 42], "time_seri": 18, "time_written": [28, 72, 80, 83, 84], "timeactual_rang": 81, "timearrai": [38, 46, 61, 68, 84, 86], "timeaxi": [46, 81], "timebound": [23, 41, 61, 72, 80, 83, 84, 87], "timedelta64": 86, "timedelta_t": 46, "timegrid_loc": 68, "timeit": [53, 83], "timelong_nam": [41, 61, 87], "timepandasindexpandasindex": [72, 81, 83, 84, 86, 87], "timeseri": [8, 18, 28, 32, 37, 39, 63, 73, 87], "timeseries_catalog": 20, "timestamp": 7, "timestep": [18, 42, 67, 72, 84, 87], "timestepunit": [72, 83, 84], "timetype_pref": 17, "timeunit": 61, "timexarrai": [46, 65], "tina": 25, "tip": [0, 11, 12, 74, 90], "tire": 16, "titl": [0, 8, 15, 17, 23, 28, 37, 38, 39, 41, 44, 46, 50, 51, 61, 64, 67, 68, 70, 72, 80, 81, 83, 86, 88], "tl319_g17": 20, "tl319_t061_zstar_n65": 86, "tl319_t13": [18, 61], "tlat": [28, 39, 43, 61, 68], "tlong": [28, 39, 43, 61, 68], "tlong_nam": 86, "tmp": [80, 86, 87], "tmpdir": [22, 43, 52], "tmpfile": 87, "to_csv": 46, "to_dataset": [11, 83], "to_dataset_dict": [20, 28, 39, 41, 42, 43, 61], "to_datetim": [11, 65], "to_datetimeindex": [11, 46], "to_netcdf": [7, 17, 43, 61, 80], "to_numpi": 80, "to_seri": 46, "to_spars": 80, "to_zarr": [7, 61, 80], "toa": 41, "toastandard_nam": 41, "toctre": 1, "todai": [15, 63, 87], "todens": [80, 83], "todo": 86, "togeth": [2, 4, 8, 23, 24, 29, 36, 39, 42, 46, 47, 62, 63, 64, 67, 73, 75, 76, 87, 90], "toggl": 88, "toil": 29, "tolist": [72, 83], "tom": 89, "ton": 45, "too": [8, 10, 25, 36, 47, 61, 62, 63, 68, 74, 84, 87], "took": [8, 10, 32, 40, 80, 83], "tool": [2, 6, 7, 8, 10, 11, 20, 24, 25, 28, 30, 31, 36, 39, 40, 43, 44, 50, 57, 61, 63, 65, 77, 78, 83, 90], "toolbar": [12, 23], "toolkit": [24, 28, 77, 92], "top": [0, 8, 15, 18, 25, 36, 37, 39, 40, 41, 43, 44, 50, 53, 56, 57, 59, 63, 65, 67, 68, 70, 78, 86], "top_grid_dimens": 67, "top_left": 65, "topic": [6, 8, 16, 24, 29, 32, 39, 62, 63, 77, 82, 83, 85, 90], "topo": [23, 38, 51, 72, 83, 84, 87], "topographi": 67, "topography_fil": [23, 51, 72, 83, 84, 87], "topographystagg": 67, "tos": 86, "tostack": 80, "total": [8, 13, 15, 23, 30, 31, 32, 37, 38, 39, 41, 51, 61, 67, 68, 72, 73, 83, 84, 86, 87, 90], "total_area": 46, "touch": [15, 69, 86], "tough": [25, 36, 63], "tour": 40, "toward": [2, 8, 10, 15, 24, 25, 29, 63, 64, 74], "town": [8, 32, 64], "tr": 18, "trace": 73, "traceback": [28, 41, 80], "tracer": [38, 86], "track": [0, 6, 7, 12, 35, 63, 73, 91], "tracker": [63, 73], "tradeoff": 47, "tradit": [2, 37, 38, 44, 84, 86], "tradition": [8, 67], "trahan": 91, "trail": [8, 71], "train": [2, 6, 8, 25, 29, 32, 59], "transfer": [46, 62, 73], "transfer_funct": 23, "transform": [2, 17, 23, 41, 67, 71, 80, 81], "transit": [2, 8, 11, 22, 25], "translat": [2, 84, 86], "transpar": 63, "transport": 72, "transportstandard_nam": 86, "transportxarrai": 72, "transpos": [47, 72, 80, 83], "treat": 69, "tree": [80, 86], "trefht": 23, "trefht_camne120": 23, "trend": [8, 63, 73], "trend_hist": 18, "trend_map": 18, "trendi": 80, "trendy2019_histori": 80, "trendy2019_s0_constant_v2": 80, "trendy2019_s0_constant_v2surface_dataset": 80, "trendy2019_s0_control_v2": 80, "tri": [15, 23, 74, 80], "trial": [8, 23, 43], "triang": 23, "triangl": [8, 23], "triangul": [23, 83], "triangular": 23, "tricki": [7, 8, 51, 67, 68, 81], "trigger": [7, 42, 44], "trim": 80, "trim_block": 15, "trivial": 87, "trmm_mam_climo": 41, "tropic": [63, 90, 91], "tropical_corn": 80, "tropical_soybean": 80, "tropopaus": 37, "troubl": [7, 45, 67, 75, 77], "troubleshoot": [75, 76], "true": [7, 8, 15, 17, 18, 20, 23, 28, 36, 37, 38, 39, 41, 43, 46, 47, 61, 67, 68, 72, 73, 80, 83, 84, 86, 87], "truediv": 68, "truevalid_rang": 80, "truncat": [46, 72, 83], "truth": 71, "try": [7, 8, 12, 17, 23, 25, 39, 41, 43, 45, 67, 68, 69, 73, 74, 75, 83, 84], "ts_remap": 83, "tseri": [7, 20, 28, 72, 84], "tsfc": [20, 28], "tsfile": 83, "tss": 80, "tstandard_nam": 86, "tt": 67, "tte_cesm": 43, "tue": 17, "tuesdai": [8, 63, 66], "tune": 23, "tupl": 80, "turn": [8, 12, 42, 73, 74, 80, 83, 86], "tutori": [6, 8, 10, 15, 17, 29, 50, 62, 63, 75, 76, 77, 81, 83, 85, 90], "tutorial_2021_12_08": 40, "tweet": [8, 23], "twenti": 39, "twice": 30, "twilight": 72, "two": [7, 8, 10, 11, 12, 14, 17, 23, 28, 30, 34, 38, 39, 41, 42, 44, 45, 46, 50, 51, 57, 61, 62, 63, 68, 71, 72, 79, 80, 81, 84, 86, 88, 90, 91], "tx0": 61, "txt": [8, 12, 16, 44, 82], "tycoon": 15, "tyle": 89, "type": [8, 11, 12, 13, 14, 15, 17, 18, 19, 20, 21, 22, 23, 25, 26, 27, 28, 32, 37, 38, 39, 41, 43, 45, 46, 48, 49, 50, 52, 53, 56, 57, 58, 61, 63, 66, 67, 68, 71, 72, 73, 74, 80, 83, 84, 86, 87, 90], "typeerror": 83, "typefloat32shap": 80, "typefloat64shap": [80, 83], "typeformatcoodata": 80, "typeint64shap": 80, "typestagg": 67, "typexarrai": 80, "typic": [8, 11, 12, 17, 23, 24, 25, 28, 29, 36, 44, 59, 62, 63, 64, 67, 68, 84], "tyx": 83, "u": [6, 7, 8, 10, 13, 16, 17, 19, 21, 22, 23, 25, 26, 27, 28, 32, 37, 38, 39, 43, 44, 46, 49, 51, 52, 54, 55, 58, 61, 63, 65, 66, 67, 69, 73, 79, 80, 83, 84, 87, 89, 90], "u11": 41, "u12": [46, 68], "u34": 39, "uat": [20, 28], "ubuntu": 44, "uc": 63, "ucar": [2, 6, 7, 8, 18, 19, 21, 22, 26, 27, 28, 33, 34, 35, 37, 38, 39, 40, 41, 43, 46, 49, 52, 54, 55, 56, 57, 58, 60, 61, 62, 66, 67, 68, 70, 78, 79, 82, 83, 84, 86, 87, 88], "ucp": 8, "uhgm": 86, "uhml": 86, "ujson": [84, 86], "uk": [8, 10], "ulat": [28, 39, 61], "ulong": [28, 39, 61], "ulrik": 2, "ultim": 74, "umo": 86, "unabl": [8, 16, 20, 28, 41], "unchunk": 73, "uncompress": [20, 28, 41, 80], "undeclar": 15, "undefin": 12, "under": [7, 20, 21, 29, 37, 43, 58, 66, 80, 83, 88], "underappreci": [8, 80], "undergradu": 2, "underli": [23, 25, 29, 80, 84], "underneath": [62, 80], "underpin": 2, "underrepres": 2, "underscor": 13, "understand": [8, 10, 25, 35, 36, 47, 50, 62, 63, 71, 74, 81, 82], "understood": 11, "unexpect": [73, 80, 83], "unfamiliar": [8, 12, 42], "unflag": 61, "unfortun": 81, "unidata": [2, 32, 40, 59, 64, 78, 87], "unifi": [61, 86], "uniform": [25, 72], "unify_chunk": 61, "uninstal": [30, 45, 75], "union": 20, "uniqu": [16, 18, 20, 28, 36, 37, 38, 39, 43, 46, 50, 61, 80], "unit": [11, 17, 20, 23, 36, 37, 38, 39, 41, 46, 47, 61, 67, 68, 72, 80, 81, 83, 84, 86, 87], "unitless": [72, 83], "univers": [2, 40, 59], "unix": 87, "unless": 87, "unlik": 71, "unlimited_dimens": 46, "unlock": 25, "unnam": 18, "unpack": 67, "unpacked_valid_rang": 81, "unprepar": [8, 15], "unscal": 10, "unseen": 63, "unset": [15, 23, 51, 72, 83], "unsetcase_id": 80, "unsetlognam": [23, 72, 83], "unsettopography_fil": 38, "unspecifi": 47, "unstack": [46, 47], "unstructur": [8, 24, 25, 30, 32, 72, 83, 85, 91, 92], "unsupris": 20, "until": [8, 66], "unus": 45, "unweight": [8, 81], "unzip": 65, "uo": 86, "up": [0, 4, 6, 8, 12, 13, 14, 15, 22, 25, 28, 29, 30, 31, 32, 45, 50, 52, 59, 61, 62, 63, 64, 73, 74, 75, 77, 79, 80, 81, 86, 87, 88, 90], "updat": [6, 7, 8, 16, 19, 21, 22, 24, 26, 28, 32, 33, 34, 35, 43, 45, 46, 49, 54, 55, 56, 58, 60, 66, 70, 72, 74, 78, 80, 82, 83, 86, 87], "upgrad": [11, 29, 73], "upon": [30, 80, 81], "upper": [0, 7, 41], "upstream": [0, 19, 25, 26, 27, 73], "uptak": 80, "upwel": 36, "urb_param": 67, "urban": [67, 80], "urban_paramet": 67, "urban_parametersstagg": 67, "urbana": 40, "url": [22, 37, 43, 46, 50, 52, 84], "us": [0, 1, 2, 4, 6, 8, 10, 11, 12, 13, 14, 16, 17, 18, 25, 29, 30, 31, 32, 34, 35, 40, 42, 45, 48, 49, 51, 53, 59, 60, 62, 63, 64, 68, 69, 73, 74, 77, 78, 79, 81, 82, 84, 87, 88, 90, 92], "usabl": [67, 92], "usag": [12, 13, 43, 45, 62, 88], "usd": 63, "use_cftim": [20, 28, 39, 86], "useless": [83, 86], "user": [0, 2, 6, 7, 8, 10, 12, 17, 20, 22, 23, 29, 31, 37, 38, 41, 42, 43, 44, 45, 46, 51, 52, 57, 61, 62, 67, 68, 71, 72, 73, 83, 84, 86, 87, 88, 90], "user_global_n": [37, 41], "user_n": [37, 41], "userbas": 25, "usernam": [43, 45, 57], "userwarn": [20, 28, 38, 41, 68, 84, 87], "usg": [23, 38, 72, 83], "usr": [22, 43, 52, 87], "usr_x": 67, "ustagg": 67, "usual": [7, 8, 10, 11, 23, 73, 74, 80, 81, 84, 86], "util": [8, 22, 23, 24, 31, 40, 43, 46, 47, 51, 52, 61, 62, 63, 65, 67, 81, 83, 87, 92], "utils_perf": 46, "uu": 67, "uvel": [20, 28], "uxarrai": [77, 83, 85, 90, 91], "v": [8, 12, 14, 25, 32, 38, 41, 61, 62, 67, 80, 84, 86], "v0": 23, "v1": [23, 44], "v2": [8, 23, 44, 46], "v2level_desc": 81, "v2pl2gv5": 37, "v3": [44, 46], "v3sourc": 46, "v4": 67, "v49contributor_nam": 61, "va": 0, "vacat": 88, "valid": [15, 39, 44, 61], "valid_rang": 81, "validation_mct": [39, 44], "validation_nu": 39, "validation_nuopc": [39, 44], "valparaiso": 40, "valu": [11, 13, 14, 17, 18, 23, 28, 32, 37, 38, 39, 46, 47, 48, 50, 61, 63, 65, 68, 71, 72, 74, 80, 81, 83, 84, 86, 87], "valuabl": [8, 10, 17, 24, 62, 88, 90], "valueerror": 80, "vander": 73, "vanderwend": 91, "vapor": [72, 77, 91], "vapour": 72, "var": [61, 67, 68, 72, 80, 83], "var_desc": 81, "var_nam": 15, "var_sso": 67, "vari": [30, 53, 62, 80, 88], "variabl": [7, 8, 11, 12, 13, 14, 15, 17, 20, 23, 24, 25, 28, 31, 36, 39, 41, 42, 43, 44, 46, 50, 51, 61, 63, 65, 68, 69, 71, 72, 73, 74, 80, 84, 86, 87], "variable_column_nam": [20, 28, 41], "variable_id": 42, "variable_typ": 44, "variablescalendar": [39, 61], "variablesmodel_doi_url": 68, "varianc": [37, 67], "variant": [37, 46], "varieti": [8, 24, 30, 31, 32, 59, 61, 62, 63, 83, 86], "variou": [6, 7, 18, 20, 29, 39, 44, 59, 63, 90], "varl": 67, "varlst": 83, "varnam": [18, 83], "vars_with_ncol": [72, 83], "varss": 67, "vdim": 23, "ve": [8, 11, 69, 83, 89], "vector": [73, 80], "vegcod": 80, "veget": 80, "veloc": [36, 67, 86], "velocitystandard_nam": 86, "velocitytime_avg_info": 86, "venu": 6, "verbal": 74, "veri": [7, 8, 10, 15, 17, 20, 23, 28, 29, 63, 71, 73, 79, 81, 83, 86, 89, 90], "verifi": [0, 7, 80], "veriou": 7, "version": [2, 7, 8, 19, 21, 23, 26, 27, 35, 40, 41, 44, 45, 46, 49, 51, 54, 55, 56, 58, 61, 66, 69, 70, 71, 72, 78, 80, 83, 86, 87], "vert": 23, "vertex": 86, "vertic": [7, 8, 18, 23, 32, 36, 39, 41, 43, 50, 63, 72], "vertical_level": [20, 36, 37, 38], "vhgm": 86, "vhml": 86, "via": [0, 1, 6, 7, 8, 22, 36, 37, 39, 42, 43, 44, 59, 74, 79, 86, 90], "vic": 17, "victori": 74, "video": [7, 8, 12, 32, 35, 40, 53, 57], "view": [1, 4, 18, 20, 24, 29, 39, 43, 52, 62, 75], "viewabl": [62, 65], "villag": 63, "vim": 12, "viridi": 38, "virtual": [6, 8, 16, 19, 21, 26, 27, 33, 34, 35, 45, 49, 54, 55, 56, 58, 62, 63, 66, 70, 75, 77, 78, 84, 85], "virtualgl": 6, "visibl": [44, 45], "vision": [8, 10, 29, 32], "visit": [40, 90], "visual": [8, 17, 18, 23, 31, 39, 44, 57, 60, 63, 65, 68, 71, 73, 75, 76, 77, 78, 84, 85, 90, 91, 92], "vital": 90, "viz": [7, 8, 33, 39, 60, 63, 77, 81], "vmax": [68, 81], "vmin": [68, 81], "vmo": 86, "vnt": 36, "vo": 86, "voic": 6, "volcello": 86, "volum": [8, 59, 61, 72, 83, 84, 86], "volumestandard_nam": 86, "volunt": [2, 63], "vsr_x": 67, "vstagger": 67, "vufi_4f6": 41, "vv": [0, 67], "vve": 36, "vvel": [20, 28, 36], "vvvvvvvabaaaaaaaaaaeafvvvvvvqaqaqqqqqqqgbaeaaaaaaaaeasqqqqqqoaqbvvvvvvvqbagaaaaaaaaeaaqqqqqqoaqb1vvvvvvqbaiaaaaaaaaeahvvvvvvuaqckqqqqqqobajaaaaaaaaealvvvvvvuaqcaqqqqqqobakaaaaaaaaeapvvvvvvuaqcqqqqqqqobalaaaaaaaaeatvvvvvvuaqc6qqqqqqobamaaaaaaaaeawqqqqqqqaqdfvvvvvvubamgaaaaaaaeayqqqqqqqaqdnvvvvvvubanaaaaaaaaea0qqqqqqqaqdvvvvvvvubangaaaaaaaea2qqqqqqqaqddvvvvvvubaoaaaaaaaaea4qqqqqqqaqdlvvvvvvubaogaaaaaaaea6qqqqqqqaqdtvvvvvvubapaaaaaaaaea8qqqqqqqaqd1vvvvvvubapgaaaaaaaea": 86, "vvvvvvvjab4aaaaaaambvaqqqqqqowg9vvvvvvvjab0aaaaaaambvkqqqqqqowg8vvvvvvvjabwaaaaaaambu6qqqqqqowg7vvvvvvvjabsaaaaaaambuqqqqqqqowg6vvvvvvvjaboaaaaaaambuaqqqqqqowg5vvvvvvvjabkaaaaaaambukqqqqqqowg4vvvvvvvjabgaaaaaaambt6qqqqqqowg3vvvvvvvjabcaaaaaaambtqqqqqqqowg2vvvvvvvjabyaaaaaaambtaqqqqqqowg1vvvvvvvjabuaaaaaaambtkqqqqqqowg0vvvvvvvjabqaaaaaaambs6qqqqqqowgzvvvvvvvjabmaaaaaaambsqqqqqqqowgyvvvvvvvjabiaaaaaaambsaqqqqqqowgxvvvvvvvjabeaaaaaaambskqqqqqqowgwvvvvvvvjabaaaaaaaambr6qqqqqqowgvvvvvvvvjaa8aaaaaaambrqqqqqqqwwguvvvvvvvjaa4aaaaaaambraqqqqqqwwgtvvvvvvvjaa0aaaaaaambrkqqqqqqwwgsvvvvvvvjaawaaaaaaambq6qqqqqqwwgrvvvvvvvjaasaaaaaaambqqqqqqqqwwgqvvvvvvvjaaoaaaaaaambqaqqqqqqwwgpvvvvvvvjaakaaaaaaambqkqqqqqqwwgovvvvvvvjaagaaaaaaambp6qqqqqqwwgnvvvvvvvjaacaaaaaaambpqqqqqqqwwgmvvvvvvvjaayaaaaaaambpaqqqqqqwwglvvvvvvvjaauaaaaaaambpkqqqqqqwwgkvvvvvvvjaaqaaaaaaambo6qqqqqqwwgjvvvvvvvjaamaaaaaaamboqqqqqqqwwgivvvvvvvjaaiaaaaaaamboaqqqqqqwwghvvvvvvvjaaeaaaaaaambokqqqqqqwwggvvvvvvvjaaaaaaaaaambn6qqqqqqwwgfvvvvvvvjaz8aaaaaaambnqqqqqqqwwgevvvvvvvjaz4aaaaaaambnaqqqqqqwwgdvvvvvvvjaz0aaaaaaambnkqqqqqqwwgcvvvvvvvjazwaaaaaaambm6qqqqqqwwgbvvvvvvvjazsaaaaaaambmqqqqqqqwwgavvvvvvvjazoaaaaaaambmaqqqqqqwwgzvvvvvvvjazkaaaaaaambmkqqqqqqwwgyvvvvvvvjazgaaaaaaambl6qqqqqqwwgxvvvvvvvjazcaaaaaaamblqqqqqqqwwgwvvvvvvvjazyaaaaaaamblaqqqqqqwwgvvvvvvvvjazuaaaaaaamblkqqqqqqwwguvvvvvvvjazqaaaaaaambk6qqqqqqwwgtvvvvvvvjazmaaaaaaambkqqqqqqqwwgsvvvvvvvjaziaaaaaaambkaqqqqqqwwgrvvvvvvvjazeaaaaaaambkkqqqqqqwwgqvvvvvvvjazaaaaaaaambj6qqqqqqwwgpvvvvvvvjay8aaaaaaambjqqqqqqqwwgovvvvvvvjay4aaaaaaambjaqqqqqqwwgnvvvvvvvjay0aaaaaaambjkqqqqqqwwgmvvvvvvvjaywaaaaaaambi6qqqqqqwwglvvvvvvvjaysaaaaaaambiqqqqqqqwwgkvvvvvvvjayoaaaaaaambiaqqqqqqwwgjvvvvvvvjaykaaaaaaambikqqqqqqwwgivvvvvvvjaygaaaaaaambh6qqqqqqwwghvvvvvvvjaycaaaaaaambhqqqqqqqwwggvvvvvvvjayyaaaaaaambhaqqqqqqwwgfvvvvvvvjayuaaaaaaambhkqqqqqqwwgevvvvvvvjayqaaaaaaambg6qqqqqqwwgdvvvvvvvjaymaaaaaaambgqqqqqqqwwgcvvvvvvvjayiaaaaaaambgaqqqqqqwwgbvvvvvvvjayeaaaaaaambgkqqqqqqwwgavvvvvvvjayaaaaaaaambf1vvvvvvgwf": 86, "vvvvvvvjab8aaaaaaambvqqqqqqqowg": 86, "vvvvvvwaaaaaaaaaaaad": 86, "vvvvvvwawd6qqqqqqsdapgaaaaaaama9vvvvvvwawdyqqqqqqsdapaaaaaaaama7vvvvvvwawdqqqqqqqsdaogaaaaaaama5vvvvvvwawdiqqqqqqsdaoaaaaaaaama3vvvvvvwawdaqqqqqqsdangaaaaaaama1vvvvvvwawdsqqqqqqsdanaaaaaaaamazvvvvvvwawdkqqqqqqsdamgaaaaaaamaxvvvvvvwawdcqqqqqqsdamaaaaaaaamauqqqqqqsawc1vvvvvvydalaaaaaaaamaqqqqqqqsawclvvvvvvydakaaaaaaaamamqqqqqqsawcvvvvvvvydajaaaaaaaamaiqqqqqqsawcfvvvvvvydaiaaaaaaaamadvvvvvvyawbqqqqqqqwdagaaaaaaaamavvvvvvvyawbkqqqqqqwdaeaaaaaaaamakqqqqqqwawavvvvvvvgdaaaaaaaaa": 86, "w": [17, 36, 41, 61, 72, 83, 84], "w_stag": 46, "wa": [8, 10, 11, 12, 13, 14, 15, 17, 23, 24, 25, 29, 30, 37, 38, 40, 41, 42, 43, 45, 46, 50, 52, 59, 61, 62, 63, 64, 71, 73, 74, 79, 81, 83, 84, 86, 87, 89, 90], "wai": [2, 7, 8, 10, 11, 14, 17, 23, 24, 29, 31, 39, 45, 53, 59, 63, 67, 69, 71, 72, 73, 74, 75, 78, 80, 84, 86, 88], "wait": [7, 8, 35, 66], "wait_count": 87, "walk": [4, 6, 8, 16, 30, 41, 44, 71, 90], "wall": [22, 23, 43, 46, 51, 52, 67, 68, 83, 84, 86, 87], "wall_tim": 20, "walltim": [20, 22, 43, 46, 52, 87], "want": [6, 8, 10, 11, 12, 13, 14, 15, 20, 22, 23, 25, 28, 29, 35, 38, 39, 43, 45, 46, 50, 52, 53, 59, 61, 62, 63, 67, 68, 69, 71, 73, 74, 80, 81, 82, 84, 87], "war": 15, "warm": 63, "warn": [8, 11, 20, 38, 39, 41, 43, 45, 46, 67, 68, 84, 87], "warren_djf_climo": 41, "wasn": [11, 67, 73, 81], "wast": 16, "watch": [21, 35, 49, 54, 55, 75, 76, 77], "water": [40, 42, 47, 61, 67, 72, 86], "watermark": [72, 83, 84, 86], "waterstagg": 67, "watsat": 80, "wav": 28, "wave": 63, "wavenumb": 46, "wavenumberarrai": 46, "wb": [84, 86], "wc_comp": 14, "wc_data": 14, "wchill": 65, "wdir": 65, "we": [2, 6, 7, 8, 12, 13, 14, 15, 16, 17, 18, 20, 23, 28, 30, 31, 32, 35, 36, 37, 38, 39, 41, 42, 43, 44, 45, 47, 48, 50, 51, 52, 59, 62, 63, 64, 65, 66, 67, 68, 69, 71, 72, 73, 75, 76, 77, 79, 80, 82, 83, 84, 85, 86, 87, 88, 89, 90], "weak": 62, "weather": [8, 12, 23, 30, 31, 61, 67, 78], "web": [0, 8, 39, 44, 59, 63, 75], "webext": 18, "webpag": [6, 8, 23, 37, 39, 44, 50], "websit": [8, 13, 15, 16, 29, 35, 44, 50, 64, 82, 92], "wed": 87, "wednesdai": [8, 16, 19, 21, 26, 27, 34, 35, 40, 49, 54, 55, 58, 63, 66, 88], "week": [8, 20, 23, 29, 38, 39, 43, 50, 51, 52, 61, 62, 63, 79, 85, 88, 90], "weekend": 88, "weekli": [30, 31, 32, 36, 59, 81], "weight": [8, 38, 61, 63, 68, 80, 81, 84], "weight_fil": [72, 83], "weightarrai": 41, "weighted_temporal_mean": [46, 68], "weightsarrai": 46, "weigth": 68, "welcom": [2, 8, 38, 88, 91], "well": [2, 6, 7, 8, 10, 12, 14, 15, 23, 24, 25, 29, 38, 40, 53, 62, 64, 69, 71, 72, 73, 80, 83, 85, 89, 90, 91], "went": [12, 79, 84, 90], "were": [8, 10, 15, 20, 24, 28, 30, 31, 39, 41, 43, 61, 63, 71, 72, 73, 76, 83, 86, 89, 90, 91], "weren": 45, "west": [41, 67], "west_east": 67, "west_east_stag": 67, "westerli": 67, "wet": 86, "wet_c": 86, "wet_u": 86, "wet_v": 86, "wetland": 80, "wget": [12, 50, 61], "wgt": [46, 68], "what": [8, 10, 12, 14, 15, 23, 25, 29, 31, 36, 39, 41, 44, 45, 47, 51, 59, 63, 72, 73, 84, 87, 88, 90], "whatev": 88, "wheel": 29, "when": [0, 4, 5, 6, 8, 10, 11, 12, 13, 14, 15, 17, 20, 23, 25, 28, 29, 31, 36, 37, 39, 41, 42, 43, 44, 45, 46, 47, 48, 50, 53, 57, 59, 61, 62, 63, 65, 67, 68, 69, 71, 73, 80, 81, 83, 84, 86, 87, 90], "whenev": [14, 69, 71], "where": [0, 6, 8, 11, 12, 13, 15, 21, 24, 25, 28, 29, 30, 37, 40, 43, 44, 45, 46, 47, 48, 50, 51, 52, 57, 58, 59, 61, 62, 66, 67, 68, 74, 75, 76, 77, 78, 79, 80, 84, 86], "wherea": [13, 46, 61, 68], "whether": [20, 59, 86], "whhqqqqqqqraceaaaaaaambx1vvvvvvwwhhkqqqqqqraccaaaaaaambxtvvvvvvuwhgqqqqqqqzacaaaaaaaambxlvvvvvvuwhgkqqqqqqzacyaaaaaaambxdvvvvvvuwhfqqqqqqqzacwaaaaaaambxvvvvvvvuwhfkqqqqqqzacuaaaaaaambxnvvvvvvuwheqqqqqqqzacsaaaaaaambxfvvvvvvuwhekqqqqqqzacqaaaaaaambw9vvvvvvuwhdqqqqqqqzacoaaaaaaambw1vvvvvvuwhdkqqqqqqzacmaaaaaaambwtvvvvvvuwhcqqqqqqqzackaaaaaaambwlvvvvvvuwhckqqqqqqzaciaaaaaaambwdvvvvvvuwhbqqqqqqqzacgaaaaaaambwvvvvvvvuwhbkqqqqqqzaceaaaaaaambwnvvvvvvuwhaqqqqqqqzaccaaaaaaambwfvvvvvvuwhakqqqqqqzacaaaaaaaambv6qqqqqqowg": 86, "which": [2, 4, 6, 7, 8, 10, 11, 12, 13, 14, 15, 17, 18, 20, 22, 23, 24, 25, 28, 29, 30, 31, 36, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 50, 51, 52, 53, 57, 59, 61, 62, 63, 64, 65, 67, 68, 69, 71, 73, 76, 79, 80, 83, 84, 87, 88, 89, 92], "while": [8, 13, 15, 16, 23, 24, 25, 29, 30, 37, 39, 41, 42, 43, 44, 46, 48, 52, 61, 62, 72, 81, 82, 83, 86, 88], "white": [13, 63], "whitepap": 32, "whitespac": 15, "who": [8, 10, 11, 12, 15, 16, 42, 63, 67, 71, 75, 76, 82, 91], "whoknowsdescript": 67, "whole": [8, 10, 47, 88], "whom": 15, "whomev": 15, "whose": 80, "why": [8, 10, 11, 13, 16, 45, 69, 73, 80], "wide": [24, 61, 63, 86], "wider": [8, 63, 64], "widespread": 15, "widget_loc": 67, "width": [18, 20, 23, 30, 39, 46, 61, 72, 80, 81], "wife": 15, "wiith": 86, "wikileak": 15, "wikipedia": 80, "wildcard": 37, "willing": 15, "willmott_04_climo": 41, "wind": [16, 38, 63], "wind_spe": 38, "wind_speed_max_plot": 65, "wind_speed_plot": 65, "windmdim": 38, "window": [12, 50, 57, 88], "windspe": [14, 65], "winter": 81, "winter_barlei": 80, "winter_ry": 80, "winter_wheat": 80, "wip": 29, "wisconsin": 40, "wish": [7, 8, 74], "within": [1, 4, 7, 8, 12, 14, 16, 18, 23, 25, 28, 36, 37, 38, 39, 40, 41, 42, 43, 44, 47, 50, 51, 57, 59, 61, 62, 63, 64, 65, 67, 68, 70, 71, 78, 80, 83, 84], "without": [8, 10, 11, 12, 13, 16, 20, 23, 28, 37, 38, 39, 45, 46, 47, 51, 52, 61, 65, 67, 68, 69, 72, 73, 80, 83, 86, 87, 90], "wmax": 65, "wnummax": 46, "woa": 61, "woa18": 61, "woa18_decav_": 61, "woa18_decav_t01_04": 61, "woa_": 61, "woa_tx0": 61, "wolfram": 63, "won": [8, 11, 69], "wonder": 7, "word": [15, 21, 24, 58, 66, 87], "work": [4, 6, 7, 8, 10, 11, 12, 13, 14, 15, 17, 20, 22, 23, 25, 28, 29, 31, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 49, 50, 51, 53, 56, 57, 59, 61, 62, 63, 64, 65, 67, 68, 69, 70, 71, 72, 74, 75, 78, 81, 82, 83, 84, 85, 86, 88, 92], "workaround": [7, 11], "worker": [8, 17, 20, 25, 28, 37, 38, 39, 41, 43, 46, 61, 62, 67, 68, 73, 83, 84, 86, 87, 88], "workflow": [2, 4, 7, 8, 10, 11, 16, 17, 25, 28, 29, 35, 38, 42, 44, 47, 50, 61, 62, 67, 68, 92], "workforc": [2, 8, 88], "workload": [8, 22], "workshop": [8, 63], "workspac": [16, 17, 45, 75, 77], "world": [8, 29, 63], "worldwid": 29, "worri": [14, 74, 84, 88], "worth": [20, 65, 84], "would": [6, 7, 8, 10, 13, 14, 15, 16, 17, 18, 19, 21, 26, 27, 28, 33, 34, 35, 36, 37, 39, 42, 43, 44, 45, 46, 48, 49, 50, 53, 54, 55, 56, 57, 58, 59, 60, 62, 63, 66, 67, 70, 71, 73, 76, 78, 80, 82, 83, 84, 86, 88, 90], "wouldn": 90, "wq": 12, "wrap": [8, 23, 62], "wrf": [8, 30, 31], "wrf_d": 67, "write": [2, 8, 11, 12, 14, 15, 16, 24, 38, 44, 62, 68, 80, 82, 83, 84, 86, 90], "written": [8, 11, 15, 24, 25, 29, 44], "wrong": [10, 72, 73], "wrote": 80, "wsdev": 65, "wspd": 65, "wt": 36, "wtt": 36, "wve": 36, "wvel": 36, "www": [28, 37, 39, 46, 61, 68], "wxobs20170821": [8, 12], "x": [8, 12, 13, 14, 17, 20, 23, 38, 41, 48, 61, 63, 67, 68, 73, 74, 80, 83, 84, 86, 88], "x00": 86, "x27": [38, 39, 41, 46, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "xarai": 29, "xarrai": [6, 8, 10, 11, 20, 23, 24, 26, 27, 28, 29, 37, 38, 39, 41, 42, 43, 44, 46, 51, 63, 65, 71, 72, 73, 75, 76, 77, 82, 83, 84, 85, 87, 91, 92], "xarray_2022_03_09": 70, "xarray_open_kwarg": 38, "xbound": 61, "xc": 17, "xc_a": [72, 83], "xc_b": [72, 83], "xclim": 7, "xcoordinate_defin": [46, 81], "xdev": [8, 13, 16, 17, 23, 24, 29, 32, 56, 82], "xdever": 32, "xdim": 63, "xe": 61, "xemsf": 90, "xesmf": [7, 8], "xgcm": [7, 24, 25, 70], "xh": 86, "xhpandasindexpandasindex": 86, "xi_rho": 73, "xi_rhoxarrai": 73, "xiearkin_09_climo": 41, "xlabel": [20, 37, 46, 81], "xlat_c": 67, "xlat_m": 67, "xlat_u": 67, "xlat_v": 67, "xlim": [37, 81], "xlong_c": 67, "xlong_m": 67, "xlong_nam": 86, "xlong_u": 67, "xlong_v": 67, "xmf87s1j": 41, "xmode": 83, "xmxl_2": 20, "xoak": [8, 25, 32, 83], "xpersist_cach": 47, "xq": 86, "xqpandasindexpandasindex": 86, "xr": [7, 8, 23, 37, 39, 41, 43, 46, 47, 51, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "xskillscor": 7, "xsparse_weight": 83, "xsparse_wgt": 83, "xtick": [37, 81], "xv": 17, "xv_a": [72, 83], "xv_b": [72, 83], "xwan": [23, 51], "xwrf": [30, 31], "xxxxxxxx": 52, "xy": [15, 67], "xyzunit": 67, "y": [8, 15, 17, 20, 23, 36, 38, 41, 47, 61, 63, 67, 68, 80, 83, 86], "y402nce5": 41, "yaml": [22, 44, 52], "yarnclust": 62, "yarrai": 87, "ybound": [38, 61], "yc": 17, "yc_a": [72, 83], "yc_b": [72, 83], "ycoordinate_defin": [46, 81], "ydim": 63, "ye": [12, 14, 15, 29, 45, 53, 73, 90], "yeager": [8, 23, 32, 42], "year": [8, 10, 11, 20, 24, 28, 29, 38, 41, 46, 59, 63, 64, 68, 80, 81, 83, 87, 89, 90], "yearli": 46, "yearly_average_weighted_correctli": 68, "yearly_average_weighted_incorrectli": 68, "yearsgrid_map": 61, "yellow": 0, "yet": [2, 8, 11, 28, 32, 38, 50, 52, 73, 84], "yh": 86, "yhpandasindexpandasindex": 86, "yield": [2, 14, 17, 42], "ylabel": [20, 37, 46, 65, 81], "ylgn": 80, "ylim": [47, 81], "ylm": 47, "ylong_nam": 86, "yml": [1, 7, 19, 21, 26, 27, 33, 34, 40, 44, 55, 58, 66, 70, 78], "you": [0, 1, 4, 6, 7, 8, 11, 12, 13, 14, 15, 16, 17, 19, 20, 21, 22, 23, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 48, 49, 50, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 73, 74, 75, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91], "your": [0, 1, 4, 6, 7, 8, 11, 12, 14, 15, 16, 19, 20, 21, 22, 25, 26, 27, 28, 29, 30, 32, 34, 35, 36, 40, 43, 45, 48, 49, 51, 52, 53, 54, 55, 56, 58, 60, 62, 63, 64, 66, 67, 68, 70, 71, 73, 75, 76, 78, 79, 80, 81, 82, 87, 90, 91], "your_address": 15, "your_nam": 15, "your_titl": 15, "yourproject": 12, "yourself": 88, "youtub": [40, 91], "yq": 86, "yqpandasindexpandasindex": 86, "ytick": [37, 81], "yv": 17, "yv6ztsj": 41, "yv_a": [72, 83], "yv_b": [72, 83], "yxc": 83, "yxt": 83, "yyi": 11, "yyyymm": 42, "yyyymmdd": [72, 80, 83, 84], "yz": 15, "z": [23, 61, 67, 68], "z3": 41, "z_i": 86, "z_ilong_nam": 86, "z_l": 86, "z_t": [18, 28, 39, 43, 47, 61, 68], "zacharia": [8, 19, 34, 49, 76, 77, 91], "zarr": [7, 20, 28, 32, 36, 41, 46, 61, 62, 63, 68, 84], "zarr_format": 86, "zarr_group_entri": 86, "zarr_kwarg": 46, "zarrai": [61, 86], "zarrstor": 61, "zattr": 86, "zedg": 86, "zenodo": [29, 63, 64], "zero": [10, 61, 80], "zgroup": 86, "zip": [14, 17], "zlake": 80, "zlon": 84, "zlon_bnd": 84, "zlon_bndsarrai": 84, "zlon_bndslong_nam": 84, "zlong_nam": 86, "zlonpandasindexpandasindex": 84, "zonal": [38, 86, 92], "zone": [25, 32], "zoom": [8, 12, 23, 39, 40, 57, 63, 75, 77, 79, 85], "zorder": 81, "zsh": 12, "zshrc": 12, "zsoi": 80, "zuckerberg": 63, "zulip": [7, 8, 29, 51, 80, 88], "zweng": 61, "zwk0f96c": 37, "zxarrai": 61, "\u00b5": [23, 83], "\u03c3": 47}, "titles": ["ESDS Blog Contributors Guide", "Earth System Data Science (ESDS)", "About Us", "Accessibility", "Best Practices", "Blog", "Communication, Meetings, and Resources", "Frequently Asked Questions", "Earth System Data Science (ESDS) Initiative", "Office Hours", "We are Xdev!", "The Significance of Time", "Python Tutorial FAQ", "Python Tutorial FAQ - Part 2", "Python Tutorial FAQ - Part 3", "Templating isn\u2019t just for Web Developers!", "Tutorial Seminar Series", "Writing multiple netCDF files in parallel with xarray and dask", "HiRes-CESM Interactive Dashboard Example", "Advanced Plotting Tutorial", "Benchmarking Performance of History vs. Timeseries Files with ecgtools, Intake-ESM, and Dask", "Cartopy Tutorial", "Using Dask on the New Casper PBS Scheduler", "Plotting CESM Data on an Unstructured Grid using Geoviews and Datashader", "CESM Diagnostics Discussion", "Dask Distributed Summit 2021 Takeaways", "Dask Tutorial", "Dask Tutorial UPDATED DATES", "Building an Intake-esm catalog from CESM2 History Files", "NCAR-CGD ESDS Town Hall", "ESDS Update November 2021", "ESDS Update October 2021", "ESDS Progress Over the Past Few Months", "GeoCAT-Comp Tutorial", "Plotting with GeoCAT Tutorial", "Git and GitHub Tutorial", "Creating Visualizations of Intake-ESM Catalogs", "Using Intake-ESM to Analyze Data from CESM2-LE", "Using Intake-ESM\u2019s New Derived Variable Functionality", "Examining Diagnostics Using Intake-ESM and hvPlot", "Intake-ESM Tutorial", "Comparing Atmospheric Model Output with Observations Using Intake-ESM", "Debugging Intake-ESM Process for Reading in CMIP6", "An Example of Using Intake-ESM", "Reimagining Diagnostics Through the Use of the Jupyter Ecosystem", "Jupyter Notebooks Tutorial FAQ", "CESM2-Large Ensemble Reproduction of Kay et al. 2015", "How to Use xarray.map_blocks for Vertical Interpolation of a 3D Field", "Matplotlib Tutorial FAQ", "Matplotlib Tutorial", "Creating Model Documentation Using Jupyterbook and Intake-esm", "Indexing unstructured grids with the Power of Xoak", "NCAR-Jobqueue", "NumPy Tutorial FAQ", "Numpy Tutorial", "Object Oriented Programming Tutorial", "Object Oriented Programming Tutorial", "Paired Programming using VS Code", "Pandas Tutorial", "Project Pythia Portal Overview", "Python Tutorial Seminar Series - Spring 2021", "Regridding High Resolution Observations to a High Resolution Model Grid", "Scaling Python with Dask Class Takeaways", "SciPy Conference 2021 Takeaways", "The Importance of Software Citation", "Processing Data from the NCAR Mesa Lab Weather Station", "Xarray Tutorial", "Reading WRF data into Xarray and Visualizing the Output using hvPlot", "Correctly Calculating Annual Averages with Xarray", "Your First Package Python Tutorial FAQ", "\u201cThinking with Xarray\u201d Tutorial", "Batch Processing Jupyter Notebooks with Papermill", "Regridding using xESMF and an existing weights file", "Debugging dask workflows: Detrending", "What I\u2019ve learned about debugging", "Preparation for a (Re)Introduction to Earth System Data Science (ESDS) Across NCAR/UCAR/UCP", "Recap of a (Re)Introduction to Earth System Data Science (ESDS) Across NCAR/UCAR/UCP", "A (Re)Introduction to Earth System Data Science (ESDS) Across NCAR/UCAR/UCP", "MetPy Tutorial", "New Office Hours Appointment System", "Sparse arrays and the CESM land model component", "Calculating Temporal Averages with GeoCAT-comp vs Xarray", "The Python Tutorial Series Returns this Summer!", "Analyzing and visualizing CAM-SE output in Python", "Cloud-optimized access to CESM Timeseries netCDF files in the Cloud with kerchunk", "2024 Earth System Data Science (ESDS) Annual Event", "Virtual aggregate CESM MOM6 datasets with kerchunk", "Thinking through CESM data access", "ESDS Office Hours Support", "ESDS at SciPy 2023", "Recap: Unstructured Grid Collaborative Work Time", "2024 ESDS Annual Event Recap", "Projects"], "titleterms": {"": [24, 28, 30, 31, 38, 73, 81], "0": 61, "08": 32, "09": 32, "1": [4, 32, 57, 71, 83], "10": 32, "11": 32, "12": 32, "14": 32, "2": [13, 32, 57, 71, 73, 83], "20": 39, "2015": 46, "2021": [25, 30, 31, 32, 60, 63], "2023": 89, "2024": [85, 91], "23": 32, "24": [32, 61], "25": 32, "26": 32, "3": [14, 57, 71, 83], "3d": 47, "4": [4, 57, 83], "5": 57, "53": 61, "A": [73, 77], "Near": 2, "The": [11, 15, 59, 61, 64, 65, 68, 81, 82], "These": 20, "_config": 50, "_toc": 50, "about": [2, 74], "absolut": 18, "access": [3, 7, 18, 20, 32, 46, 84, 87], "acknowledg": [76, 91], "across": [75, 76, 77], "action": 44, "activ": 6, "ad": [41, 50], "adapt": 83, "add": [38, 50, 61, 74, 83], "addit": [28, 81], "adf": 92, "advanc": [19, 31], "advic": 7, "again": 73, "agenda": 76, "aggreg": 86, "al": 46, "all": [65, 80, 81], "am": 64, "amazon": 84, "an": [23, 28, 38, 41, 43, 44, 61, 65, 72, 73, 83, 84, 89], "anaconda": 25, "analysi": [4, 6, 7, 44, 89], "analyz": [37, 83], "annual": [38, 43, 46, 68, 85, 91], "anoth": 71, "answer": [7, 29], "appendix": 20, "appli": [20, 23, 37, 38, 42, 43, 47, 72, 80, 83], "apply_ufunc": 80, "appoint": [79, 88], "approach": 84, "april": 32, "ar": [7, 10, 24, 61], "arch": 24, "architectur": 4, "area": 46, "around": 61, "arrai": [37, 80, 83], "asid": 80, "ask": [7, 29], "assumpt": 35, "atla": 61, "atmospher": [41, 63, 92], "attempt": 73, "august": 32, "authent": 7, "autom": [44, 89], "avail": 84, "averag": [39, 41, 46, 68, 81], "awsig": 6, "axi": 65, "back": [25, 80], "background": [63, 71], "batch": [22, 71], "befor": [24, 35], "below": 46, "benchmark": [20, 84], "best": [4, 11, 62], "beta": 28, "better": [24, 73, 87, 89], "binder": 75, "bio": [40, 56, 70, 78, 82], "blog": [0, 5, 30, 31, 32], "book": [44, 50, 59], "both": 11, "branch": 50, "breakout": 76, "bring": [20, 65, 89], "bucket": 84, "bug": 73, "build": [1, 18, 20, 28, 41, 44, 50, 73, 83, 89], "built": 89, "calcul": [38, 43, 46, 47, 65, 68, 81], "calendar": [6, 16, 82], "call": 38, "cam": 83, "can": [7, 25, 52], "cartopi": [21, 32], "case": [11, 15, 36], "casper": [22, 52], "catalog": [20, 28, 36, 37, 41, 46, 50, 92], "caus": 42, "celebr": 74, "cell": 44, "cesm": [7, 18, 23, 24, 36, 41, 43, 50, 80, 84, 86, 87, 92], "cesm2": [28, 37, 41, 46, 68], "cftime": 11, "cgd": [29, 90], "challeng": [37, 63, 73, 81], "chang": 74, "check": 74, "checkout": 50, "choos": 87, "chunk": [83, 87], "cisl": 90, "citat": [29, 32, 64], "cite": 64, "class": 62, "client": 83, "climat": 89, "climatologi": 41, "clm": 80, "clone": 50, "cloud": 84, "cluster": [20, 37, 38, 39, 43, 46, 62, 67, 68, 83, 84, 87], "cmip6": 42, "code": [7, 17, 44, 57, 74], "codebas": 74, "collabor": [57, 90, 91], "colleagu": 24, "colorbar": 61, "combin": [43, 86, 87], "come": 24, "command": [7, 71], "comment": [24, 63], "committe": 2, "commun": [2, 6, 24, 63, 80, 92], "comp": [32, 33, 61, 81, 92], "compar": [41, 61], "comparison": [20, 39], "compon": [36, 50, 80], "compress": 80, "comput": [4, 17, 20, 25, 29, 30, 31, 32, 39, 41, 46, 61, 62, 81, 83], "concaten": 87, "conclus": [17, 20, 28, 36, 37, 39, 41, 44, 50, 61, 62, 65, 67, 68], "conda": [7, 20, 30], "confer": [32, 63], "config": 50, "configur": 44, "confirm": 17, "conlcus": 23, "consid": 88, "construct": [72, 80, 83], "contain": 18, "content": [44, 50, 83], "contribut": [24, 89], "contributor": 0, "convert": [46, 65, 80], "coordin": 83, "copi": 50, "core": 83, "correct": 81, "correctli": 68, "could": 24, "cover": 35, "creat": [7, 17, 36, 38, 39, 50, 83, 84, 86, 87, 88], "csv": 18, "ctsm": 92, "cube": 89, "cupid": 92, "d": 83, "dagon": 90, "daili": 46, "dashboard": [18, 62], "dask": [7, 17, 20, 22, 25, 26, 27, 29, 30, 31, 32, 37, 38, 39, 43, 52, 62, 73, 80, 87], "data": [1, 7, 8, 18, 23, 28, 29, 30, 31, 32, 37, 38, 39, 41, 43, 46, 47, 61, 62, 63, 65, 67, 68, 72, 75, 76, 77, 81, 83, 85, 86, 87, 89], "dataarrai": 80, "datafram": 46, "dataset": [17, 23, 37, 39, 41, 43, 46, 47, 67, 86, 87], "datashad": 23, "datatre": 86, "date": [27, 60], "datetime64": 11, "datetimenoleap": 11, "deal": [7, 18, 65], "debug": [7, 42, 73, 74], "defin": [37, 83], "demo": 86, "demonstr": 81, "depth": 47, "deriv": 38, "describ": 23, "design": [4, 29], "desir": 37, "destin": 83, "determin": 42, "detrend": 73, "develop": [15, 24, 38, 63], "diagnost": [24, 29, 39, 44, 92], "dictionari": [39, 86], "differ": [20, 52, 68, 81], "dimens": [80, 83], "direct": 83, "directli": [84, 89], "directori": [28, 50], "discoveri": 63, "discuss": [24, 30, 31, 32], "disk": [43, 87], "distribut": [25, 62, 83], "do": [7, 24, 29, 64], "doc": 50, "document": [23, 32, 50, 74], "doi": 64, "down": 46, "download": [28, 50, 57], "each": 84, "earth": [1, 8, 75, 76, 77, 85, 92], "easi": 80, "ecgtool": [20, 28, 41, 92], "ecosystem": 44, "effort": 92, "els": 64, "email": 6, "enabl": [24, 57], "end": [30, 31, 32, 89], "engin": 24, "ensembl": 46, "entir": [47, 80], "environ": [7, 71, 75], "eroglu": 90, "error": [42, 74], "esd": [0, 1, 2, 6, 8, 25, 29, 30, 31, 32, 75, 76, 77, 85, 88, 89, 91], "esm": [20, 28, 36, 37, 38, 39, 40, 41, 42, 43, 46, 50, 92], "esm_catalog_util": 92, "et": 46, "evalu": 89, "event": [2, 76, 85, 91], "exactli": 67, "examin": [39, 67], "exampl": [18, 22, 32, 36, 43, 73, 86, 92], "execut": 71, "exist": 72, "experi": [35, 41], "export": 7, "extract": [46, 83], "fair": 50, "falko": 90, "faq": [12, 13, 14, 45, 48, 53, 69], "far": [16, 82], "featur": 24, "fernando": 63, "few": 32, "field": 47, "file": [7, 17, 18, 20, 28, 41, 44, 50, 67, 72, 83, 84, 86, 87], "filepath": 17, "filesystem": 86, "final": [39, 71, 73], "find": [7, 29], "first": [69, 83, 87], "fix": [61, 73], "follow": 60, "forg": [20, 61], "format": 81, "forum": [6, 25, 30, 31], "foundat": 59, "framework": 92, "frequenc": 50, "frequent": 7, "friendli": 89, "from": [24, 28, 37, 39, 41, 46, 50, 61, 65, 71, 81, 84], "function": [7, 17, 23, 37, 38, 39, 41, 61, 65, 68, 81, 83], "fund": 29, "further": [80, 83], "futur": 73, "galleri": [59, 92], "garden": 89, "gather": 84, "gener": [7, 17, 30, 31, 84, 86, 92], "geocat": [32, 33, 34, 61, 81, 92], "geospati": 89, "geoview": 23, "git": [32, 35], "github": [6, 7, 32, 35, 44, 50], "given": 24, "go": [7, 50], "goal": [2, 80], "gpu": 89, "grab": [46, 67], "graphviz": 36, "grid": [23, 46, 51, 61, 83, 90], "group": [2, 6, 24, 37, 76, 86], "growth": 25, "guid": [0, 76], "h": 86, "hall": 29, "have": 7, "heatwav": 63, "help": [4, 7], "helper": [17, 37, 39, 61, 81], "here": 61, "high": [25, 61], "hire": 18, "histor": 41, "histori": [20, 25, 28, 50], "holoview": [23, 39], "home": 89, "homework": 75, "hour": [6, 9, 30, 31, 32, 79, 88], "how": [7, 24, 25, 29, 38, 40, 44, 47, 52, 56, 64, 70, 71, 78, 82], "hpc": [4, 7, 25], "hvplot": [39, 61, 67], "i": [7, 38, 52, 61, 64, 67, 71, 73, 74, 80, 86], "imag": 63, "import": [17, 20, 23, 28, 36, 37, 38, 39, 41, 43, 46, 47, 50, 61, 64, 65, 67, 68, 80, 81, 83, 84], "improv": [47, 72], "incorpor": 24, "incorrect": 81, "incorrectli": 68, "index": 51, "info": 81, "ingest": 47, "inherit": 15, "initi": 8, "inlin": [18, 86], "input": 17, "insight": 63, "inspect": 28, "instal": [20, 38, 50, 67, 75], "instead": 83, "intak": [20, 28, 36, 37, 38, 39, 40, 41, 42, 43, 46, 50, 92], "interact": [18, 29, 44, 61, 65, 89], "intercomparison": 20, "interest": [6, 61], "interpol": [47, 61], "introduct": [46, 62, 75, 76, 77, 80], "intuit": 74, "investig": [41, 67], "invit": 91, "invok": 17, "isn": 15, "jinja2": 15, "jobqueu": 52, "join": [60, 88], "judt": 90, "juli": 32, "june": 32, "jupyt": [36, 44, 45, 71, 89], "jupyterbook": 50, "jupyterhub": 7, "just": [15, 20, 80], "kai": 46, "kati": 90, "keep": 89, "kerchunk": [84, 86], "keynot": 63, "kill": 7, "killedwork": 7, "lab": 65, "land": 80, "landscap": 29, "larg": 46, "last": 39, "layer": 47, "lazili": 46, "le": [36, 37, 41, 43, 68], "leadership": 2, "learn": [6, 59, 74, 81, 89], "let": 73, "letter": 15, "level": [61, 67], "librari": 80, "line": [7, 71], "link": [25, 50], "list": [6, 67, 84, 87], "load": [17, 38, 39, 46, 68], "local": [1, 20, 75], "locat": 83, "login": [22, 57], "logo": 50, "long": [7, 89], "look": [7, 37, 44, 62, 68, 73], "loop": 36, "lot": 7, "machin": [50, 89], "mai": 32, "main": [24, 36, 37], "make": [61, 64, 80, 81, 83, 87], "mamba": 7, "manag": 4, "mani": 80, "map": [61, 83, 84], "map_block": 47, "mapper": [84, 86], "march": 32, "marin": 63, "markdown": 44, "materi": 76, "matplotlib": [30, 31, 32, 48, 49], "matrix": 83, "matter": 87, "me": 17, "mean": [38, 41, 43, 46, 61], "meet": [6, 24, 57], "member": 2, "membership": 6, "memori": 7, "merg": 84, "mesa": 65, "messag": 74, "metadata": 18, "meteogram": 65, "method": [61, 83, 84], "metpi": [78, 89], "mindset": 74, "mint": 64, "mix": 47, "mmm": 90, "model": [4, 29, 41, 50, 61, 63, 80, 89, 92], "modifi": 67, "modular": 92, "mom6": [86, 92], "monitor": [7, 63], "month": 32, "monthli": [7, 20, 39, 41, 61, 81], "morpholog": 63, "motiv": 71, "much": [7, 24], "multipl": [7, 17, 80], "multipli": 83, "must": 7, "my": [7, 52, 64], "nbscuid": 92, "ncar": [4, 7, 29, 52, 64, 65, 75, 76, 77, 89], "netcdf": [17, 84], "new": [7, 22, 24, 38, 52, 63, 65, 79, 87, 88], "next": 86, "note": 87, "notebook": [36, 44, 45, 71, 89], "novemb": 30, "npl": 7, "nsf": [4, 7], "numpi": [25, 32, 53, 54], "object": [30, 32, 55, 56], "observ": [41, 46, 61], "ocean": [20, 61, 92], "ocetrac": 63, "octob": 31, "offic": [6, 9, 30, 31, 32, 79, 88], "older": 73, "one": 37, "onto": 83, "open": [63, 87, 89], "open_dataset": 86, "oper": [43, 47, 73, 80], "opportun": 47, "opt_einsum": 83, "optim": [7, 84], "option": [71, 87], "organ": [6, 64], "orhan": 90, "orient": [30, 32, 55, 56], "other": 89, "our": [23, 37, 38, 39, 42, 44, 46, 65], "out": 20, "output": [7, 17, 20, 38, 39, 41, 46, 47, 67, 80, 83, 84, 86], "outsid": 64, "over": [24, 32], "overal": 29, "overview": [24, 30, 31, 32, 59, 62, 83, 91], "own": 88, "packag": [4, 17, 20, 24, 29, 30, 31, 32, 69], "page": [7, 50], "pair": 57, "panda": [32, 58], "pangeo": [25, 61], "papermil": 71, "parallel": [7, 17, 29, 92], "parameter": 44, "pars": 41, "parse_cesm_histori": 20, "parse_cesm_timeseri": 20, "parser": [20, 41], "part": [13, 14, 32], "particip": 6, "past": [2, 32, 35], "path": 18, "pb": 22, "peopl": 64, "perez": 63, "perform": [17, 20, 25, 83], "pipelin": [87, 89], "plan": 90, "platform": 6, "pleas": [17, 60], "plot": [18, 19, 20, 23, 31, 34, 37, 38, 39, 41, 44, 46, 61, 65, 67, 80, 81, 84], "polyfit": 73, "polyv": 73, "pop": [29, 92], "portal": 59, "portion": 29, "possibl": 72, "post": [8, 30, 31, 32], "poster": 89, "postprocess": 92, "potenti": 47, "power": 51, "practic": [4, 62], "prepar": [19, 21, 26, 27, 33, 34, 35, 46, 49, 54, 55, 58, 66, 71, 75], "preprocess": [44, 87], "preprocessor": 65, "present": 76, "print": 74, "problem": [65, 68, 74], "process": [42, 63, 65, 71], "program": [30, 32, 55, 56, 57, 92], "progress": 32, "project": [6, 29, 59, 89, 92], "properli": 17, "public": 29, "push": 50, "put": 80, "pythia": [6, 59, 89], "python": [12, 13, 14, 30, 31, 32, 60, 62, 69, 71, 82, 83, 92], "queri": [37, 41], "question": [7, 29, 30, 31, 80], "re": [75, 76, 77], "read": [7, 18, 20, 23, 28, 36, 37, 38, 39, 41, 42, 43, 46, 50, 61, 67, 72, 81, 83, 84, 86, 87], "rebuild": 50, "recap": [76, 90, 91], "recent": 8, "rechunk": 7, "record": [40, 76], "refer": [84, 86], "registri": 38, "regrid": [61, 72, 83], "regridd": [72, 83], "reimagin": 44, "rel": 18, "remap": 83, "remot": 57, "repositori": [4, 6, 50, 64], "repres": 2, "reproduc": 42, "reproduct": 46, "requir": 24, "reshap": 83, "resolut": 61, "resourc": [4, 6, 7, 32, 59, 76, 91], "result": [23, 37], "return": [37, 82], "run": [18, 40, 47, 56, 63, 70, 71, 78, 82], "s3": 84, "same": 81, "sampl": [41, 50], "save": [20, 28, 41, 50, 62], "save_mfdataset": 17, "scalabl": 89, "scale": [62, 83], "schedul": 22, "scienc": [1, 8, 75, 76, 77, 85], "scientif": [4, 89], "scipi": [25, 63, 89], "script": 71, "se": 83, "search": [20, 43, 74], "season": [41, 46, 81], "seminar": [16, 60], "septemb": 32, "seri": [16, 60, 82], "session": [25, 75], "set": [7, 43, 44, 83], "setup": [23, 46, 57, 65, 73, 86], "sfc": 86, "share": 57, "shift": 29, "should": 64, "show": 17, "sicenc": 63, "sign": [16, 19, 21, 26, 27, 33, 34, 35, 40, 49, 54, 55, 56, 58, 60, 66, 70, 78, 82], "signific": 11, "simpl": 86, "singl": [80, 86, 87], "site": 1, "size": 87, "slide": 76, "slow": 7, "small": 87, "so": [16, 81, 82], "softwar": [4, 24, 64], "solut": [65, 68], "solv": 7, "some": [17, 46], "someon": 7, "someth": 7, "sourc": [63, 83, 89], "space": 83, "spars": [80, 83], "special": 6, "speed": 20, "spin": [20, 37, 38, 39, 43, 46, 67, 68, 83, 84], "split": 17, "spring": 60, "standard": 65, "start": [7, 59, 87], "statement": [15, 74], "static": 86, "station": 65, "step": [7, 71, 88], "structur": [28, 41, 83], "sub": 17, "subset": [37, 39, 46, 61, 87], "success": 63, "summari": [32, 73, 80, 83, 84, 86], "summer": 82, "summit": 25, "support": 88, "sure": [61, 64], "surfac": 83, "sustain": 89, "system": [1, 8, 25, 75, 76, 77, 79, 85, 92], "t": [15, 41, 83], "tabl": [44, 50], "take": [7, 44, 68], "takeawai": [24, 25, 62, 63, 90], "talk": [25, 32, 74, 89, 91], "task": 11, "team": 88, "technic": 29, "temperatur": [41, 46, 65, 83], "templat": [4, 15], "tempor": [39, 46, 81], "temptat": 11, "term": [2, 89], "terrestri": 92, "test": [20, 50, 80, 83, 87], "than": 52, "them": 7, "theme": 24, "thi": [7, 23, 25, 35, 47, 52, 63, 82, 83], "think": [24, 70, 87], "thought": 71, "through": [36, 44, 61, 87], "tidi": 89, "tie": 25, "time": [7, 11, 20, 61, 65, 67, 83, 90, 91], "timeseri": [20, 84], "timestep": [80, 83], "tip": [1, 7], "to_dataset_dict": [37, 38, 46], "togeth": [20, 65, 80, 84], "toi": 17, "too": 7, "tool": [29, 89, 92], "toolkit": 63, "toolsin": 63, "topic": 7, "total": 46, "town": 29, "traiangul": 23, "transpar": 29, "trefht": 46, "tribul": 11, "trimesh": 23, "trust": 74, "try": 87, "tutori": [7, 12, 13, 14, 16, 19, 21, 26, 27, 30, 31, 32, 33, 34, 35, 40, 45, 48, 49, 53, 54, 55, 56, 58, 60, 66, 69, 70, 78, 82, 89, 91], "two": 20, "type": 88, "u": [2, 60], "ucar": [75, 76, 77, 89], "ucp": [75, 76, 77], "understand": [28, 86], "unidata": 89, "unifi": 92, "unit": 65, "unstructur": [23, 51, 90], "up": [7, 16, 19, 20, 21, 26, 27, 33, 34, 35, 37, 38, 39, 40, 41, 43, 44, 46, 49, 54, 55, 56, 58, 60, 66, 67, 68, 70, 72, 78, 82, 83, 84], "updat": [25, 27, 30, 31, 52], "us": [7, 15, 20, 22, 23, 24, 28, 36, 37, 38, 39, 41, 43, 44, 46, 47, 50, 52, 57, 61, 65, 67, 71, 72, 80, 83, 86, 89], "usabl": 29, "user": [24, 25, 89], "util": 86, "uxarrai": 92, "v": [18, 20, 57, 81], "valu": [2, 41, 67], "variabl": [37, 38, 67, 83], "ve": 74, "vector": 83, "vegtyp": 80, "version": [28, 38, 73], "vertic": [47, 61, 67], "via": 20, "view": 50, "virtual": [57, 60, 86], "vision": 2, "visual": [20, 32, 36, 47, 50, 67, 72, 80, 83], "viz": [32, 92], "volunt": 24, "wai": 81, "wall": 20, "want": [7, 64, 88], "warn": 50, "we": [10, 24, 25, 29, 46, 61, 81], "weather": 65, "web": 15, "weight": [46, 72, 83], "well": 67, "were": 17, "what": [7, 24, 28, 38, 62, 67, 71, 74, 80, 81, 86], "when": [7, 74], "where": 7, "which": 37, "whole": 87, "why": [44, 62, 64], "wind": 65, "within": [24, 52], "without": 84, "work": [2, 24, 32, 73, 80, 87, 89, 90, 91], "workaround": 42, "worker": 7, "workflow": [6, 24, 30, 31, 32, 52, 73, 89], "workshop": 24, "world": [11, 61], "would": [24, 52, 64], "wrap": [65, 68, 72, 80], "wrf": 67, "write": [7, 17, 29, 43], "written": [7, 17], "wrong": 7, "x": 7, "xarrai": [7, 17, 25, 30, 31, 32, 47, 61, 62, 66, 67, 68, 70, 80, 81, 86, 89], "xdev": [10, 30, 31], "xesmf": [61, 72, 83], "xoak": 51, "xr": 17, "xwrf": 67, "year": [37, 39, 61], "yearli": 68, "yml": 50, "you": 24, "your": [24, 50, 57, 69, 74, 88], "yourself": 74, "zarr": [29, 86], "zen": 4, "zulip": 6}}) \ No newline at end of file +Search.setIndex({"alltitles": {"1. Download VS Code": [[57, "download-vs-code"]], "1. Regrid CAM-SE output using map file": [[83, "regrid-cam-se-output-using-map-file"]], "2. Setup Remote Login": [[57, "setup-remote-login"]], "2. Use a CAM-SE remap function to scale up": [[83, "use-a-cam-se-remap-function-to-scale-up"]], "2024 ESDS Annual Event Recap": [[92, "esds-annual-event-recap"]], "2024 Earth System Data Science (ESDS) Annual Event": [[85, "earth-system-data-science-esds-annual-event"]], "3. Enable Sharing": [[57, "enable-sharing"]], "3. Regrid CAM-SE output using xESMF": [[83, "regrid-cam-se-output-using-xesmf"]], "4+1 Software Architecture Model": [[4, "software-architecture-model"]], "4. Direct sparse matrix multiply-add": [[83, "direct-sparse-matrix-multiply-add"]], "4. Setup Your Virtual Meeting": [[57, "setup-your-virtual-meeting"]], "5. Collaborate!": [[57, "collaborate"]], "A (Re)Introduction to Earth System Data Science (ESDS) Across NCAR/UCAR/UCP": [[77, "a-re-introduction-to-earth-system-data-science-esds-across-ncar-ucar-ucp"]], "A dask bug": [[73, "a-dask-bug"]], "About Us": [[2, "about-us"]], "Accessibility": [[3, "accessibility"]], "Accessing the Data (Plots)": [[18, "accessing-the-data-plots"]], "Acknowledgements": [[76, "acknowledgements"], [92, "acknowledgements"]], "Add Jupyterbook files": [[50, "add-jupyterbook-files"]], "Add a Helper Function to Make Sure the Colorbar is around 0": [[61, "add-a-helper-function-to-make-sure-the-colorbar-is-around-0"]], "Add print statements to your code": [[74, "add-print-statements-to-your-code"]], "Add to your Table of Contents (_toc.yml) file": [[50, "add-to-your-table-of-contents-toc-yml-file"]], "Adding the parsing function": [[41, "adding-the-parsing-function"]], "Adding to your Config (_config.yml) file": [[50, "adding-to-your-config-config-yml-file"]], "Additional Imports": [[28, "additional-imports"]], "Additional Info": [[81, "additional-info"]], "Advanced Plotting Tutorial": [[19, "advanced-plotting-tutorial"], [31, "advanced-plotting-tutorial"]], "Agenda": [[76, "agenda"]], "An Example of Using Intake-ESM": [[43, "an-example-of-using-intake-esm"]], "An older dask version": [[73, "an-older-dask-version"]], "Analysis Repository": [[4, "analysis-repository"]], "Analysis Workflow Special Interest Group (AWSIG)": [[6, "analysis-workflow-special-interest-group-awsig"]], "Analyzing and visualizing CAM-SE output in Python": [[83, "analyzing-and-visualizing-cam-se-output-in-python"]], "Appendix": [[20, "appendix"]], "Apply an Annual Mean Calculation": [[38, "apply-an-annual-mean-calculation"]], "Apply an operation": [[43, "apply-an-operation"]], "Apply our function": [[37, "apply-our-function"]], "Apply remap function onto first timestep of TS": [[83, "apply-remap-function-onto-first-timestep-of-ts"]], "Apply sparse map onto first timestep of TS": [[83, "apply-sparse-map-onto-first-timestep-of-ts"]], "Apply the Computation with History Files": [[20, "apply-the-computation-with-history-files"]], "Apply the Computation with Timeseries": [[20, "apply-the-computation-with-timeseries"]], "Apply the Regridder": [[72, "apply-the-regridder"]], "Apply the regridder": [[83, "apply-the-regridder"]], "Apply the search for data": [[43, "apply-the-search-for-data"]], "Apply this function to our dataset": [[23, "apply-this-function-to-our-dataset"]], "Apply to entire dask DataArray": [[80, "apply-to-entire-dask-dataarray"]], "Apply weights": [[83, "apply-weights"]], "Applying Mixed Layer Depth Calculation": [[47, "applying-mixed-layer-depth-calculation"]], "Applying our \u201cWorkaround\u201d": [[42, "applying-our-workaround"]], "Approach": [[84, "approach"]], "Aside: further compressing the vegtype dimension": [[80, "aside-further-compressing-the-vegtype-dimension"]], "Asking Questions": [[29, "asking-questions"]], "Assumptions of past Git experience": [[35, "assumptions-of-past-git-experience"]], "Atmosphere Diagnostics Framework (ADF)": [[93, "atmosphere-diagnostics-framework-adf"]], "Atmospheric data Community Toolkit": [[63, "atmospheric-data-community-toolkit"]], "Attempt 2": [[73, "attempt-2"]], "Automating the Book Build using Github Actions": [[44, "automating-the-book-build-using-github-actions"]], "Back to CLM output": [[80, "back-to-clm-output"]], "Background": [[63, "background"]], "Background and Motivation": [[71, "background-and-motivation"]], "Batch Processing Jupyter Notebooks with Papermill": [[71, "batch-processing-jupyter-notebooks-with-papermill"]], "Benchmark Reading in from Kerchunk mappings": [[84, "benchmark-reading-in-from-kerchunk-mappings"]], "Benchmarking Performance of History vs. Timeseries Files with ecgtools, Intake-ESM, and Dask": [[20, "benchmarking-performance-of-history-vs-timeseries-files-with-ecgtools-intake-esm-and-dask"]], "Best Practices": [[4, "best-practices"], [62, "best-practices"]], "Better (Open Source) Homes and Gardens with Project Pythia": [[89, "better-open-source-homes-and-gardens-with-project-pythia"]], "Binder": [[75, "binder"]], "Bio": [[40, "bio"], [56, "bio"], [70, "bio"], [78, "bio"], [82, "bio"]], "Blog": [[5, "blog"]], "Blog Posts": [[32, "blog-posts"]], "Breakout Group Materials": [[76, "breakout-group-materials"]], "Bringing These Two Together": [[20, "bringing-these-two-together"]], "Bringing automated data analysis and machine learning pipelines directly to end users using Unidata tools": [[89, "bringing-automated-data-analysis-and-machine-learning-pipelines-directly-to-end-users-using-unidata-tools"]], "Bringing it All Together": [[65, "bringing-it-all-together"]], "Build a parser using ecgtools": [[41, "build-a-parser-using-ecgtools"]], "Build an Intake-ESM catalog from the observational dataset": [[41, "build-an-intake-esm-catalog-from-the-observational-dataset"]], "Build data array with dimension and coordinates": [[83, "build-data-array-with-dimension-and-coordinates"]], "Build the Catalogs": [[20, "build-the-catalogs"]], "Build the Dashboard": [[18, "build-the-dashboard"]], "Build the History File Catalog": [[20, "build-the-history-file-catalog"]], "Build the Timeseries Catalog": [[20, "build-the-timeseries-catalog"]], "Build the book and push to your Github Pages branch": [[50, "build-the-book-and-push-to-your-github-pages-branch"]], "Build the catalog using the parse_cesm_history parser": [[20, "build-the-catalog-using-the-parse-cesm-history-parser"]], "Build the catalog using the parse_cesm_timeseries parser": [[20, "build-the-catalog-using-the-parse-cesm-timeseries-parser"]], "Build the catalog!": [[28, "build-the-catalog"]], "Build your Book!": [[50, "build-your-book"]], "Build your Catalog": [[50, "build-your-catalog"]], "Building MetPy for the Long Term: Working to Keep an Open Source Project Sustainable": [[89, "building-metpy-for-the-long-term-working-to-keep-an-open-source-project-sustainable"]], "Building a better polyval": [[73, "building-a-better-polyval"]], "Building an Intake-esm catalog from CESM2 History Files": [[28, "building-an-intake-esm-catalog-from-cesm2-history-files"]], "CESM Data": [[7, "cesm-data"]], "CESM Diagnostics Discussion": [[24, "cesm-diagnostics-discussion"]], "CESM MOM6 output": [[86, "cesm-mom6-output"]], "CESM Unified Postprocessing and Diagnostics (CUPiD)": [[93, "cesm-unified-postprocessing-and-diagnostics-cupid"]], "CESM2-Large Ensemble Reproduction of Kay et al. 2015": [[46, "cesm2-large-ensemble-reproduction-of-kay-et-al-2015"]], "Calculate an annual mean": [[43, "calculate-an-annual-mean"]], "Calculate the Annual Average Incorrectly": [[68, "calculate-the-annual-average-incorrectly"]], "Calculating Temporal Averages with GeoCAT-comp vs Xarray": [[81, "calculating-temporal-averages-with-geocat-comp-vs-xarray"]], "Calculating the New Time Axis": [[65, "calculating-the-new-time-axis"]], "Calculating the Yearly Average Correctly": [[68, "calculating-the-yearly-average-correctly"]], "Calendar So Far": [[16, "calendar-so-far"], [82, "calendar-so-far"]], "Calling to_dataset_dict to Load in the Data": [[38, "calling-to-dataset-dict-to-load-in-the-data"]], "Cartopy Tutorial": [[21, "cartopy-tutorial"]], "Cartopy Tutorial (26 April 2021)": [[32, "cartopy-tutorial-26-april-2021"]], "Celebrate when the error message changes": [[74, "celebrate-when-the-error-message-changes"]], "Challenges": [[81, "challenges"]], "Challenges of detrending": [[73, "challenges-of-detrending"]], "Change your mindset": [[74, "change-your-mindset"]], "Check the Codebase": [[74, "check-the-codebase"]], "Check the Documentation": [[74, "check-the-documentation"]], "Choosing a chunk size": [[87, "choosing-a-chunk-size"]], "Choosing combine options": [[87, "choosing-combine-options"]], "Chunking in space": [[83, "chunking-in-space"]], "Climate Model Evaluation Workflow Built on Jupyter Notebooks": [[89, "climate-model-evaluation-workflow-built-on-jupyter-notebooks"]], "Clone to your machine!": [[50, "clone-to-your-machine"]], "Clone your Repository": [[50, "clone-your-repository"]], "Cloud-optimized access to CESM Timeseries netCDF files in the Cloud with kerchunk": [[84, "cloud-optimized-access-to-cesm-timeseries-netcdf-files-in-the-cloud-with-kerchunk"]], "Collaborative Work Time": [[92, "collaborative-work-time"]], "Combine datasets to single Zarr with groups": [[86, "combine-datasets-to-single-zarr-with-groups"]], "Combine the datasets": [[43, "combine-the-datasets"]], "Comments on the Open Development Model": [[63, "comments-on-the-open-development-model"]], "Communication Platforms": [[6, "communication-platforms"]], "Communication, Meetings, and Resources": [[6, "communication-meetings-and-resources"]], "Community Land Model (CLM) output": [[80, "community-land-model-clm-output"]], "Community Meetings": [[6, "community-meetings"]], "Community Terrestrial Systems Model (CTSM) Python Gallery": [[93, "community-terrestrial-systems-model-ctsm-python-gallery"]], "Community Working Group": [[2, "community-working-group"]], "Compare the Model to Observations": [[61, "compare-the-model-to-observations"]], "Comparing Atmospheric Model Output with Observations Using Intake-ESM": [[41, "comparing-atmospheric-model-output-with-observations-using-intake-esm"]], "Compute": [[83, "compute"]], "Compute Monthly and Seasonal Averages": [[41, "compute-monthly-and-seasonal-averages"]], "Compute the Averages": [[46, "compute-the-averages"]], "Compute the Monthly Mean using Geocat-Comp": [[61, "compute-the-monthly-mean-using-geocat-comp"]], "Compute the Temporal Average": [[39, "compute-the-temporal-average"]], "Compute the Weighted Annual Averages": [[46, "compute-the-weighted-annual-averages"]], "Compute the Weighted Temporal Mean from Seasons": [[46, "compute-the-weighted-temporal-mean-from-seasons"]], "Conclusion": [[17, "conclusion"], [28, "conclusion"], [36, "conclusion"], [37, "conclusion"], [39, "conclusion"], [41, "conclusion"], [50, "conclusion"], [61, "conclusion"], [62, "conclusion"], [65, "conclusion"], [68, "conclusion"]], "Conclusions": [[20, "conclusions"], [44, "conclusions"], [67, "conclusions"]], "Conda Questions": [[30, "conda-questions"]], "Conda is taking too long to solve environment: use mamba": [[7, "conda-is-taking-too-long-to-solve-environment-use-mamba"]], "Conference Summaries, Discussions, and Resources": [[32, "conference-summaries-discussions-and-resources"]], "Confirm that the output files were properly written": [[17, "confirm-that-the-output-files-were-properly-written"]], "Conlcusion": [[23, "conlcusion"]], "Considering Joining the Office Hours Team?": [[88, "considering-joining-the-office-hours-team"]], "Construct a Regridder.": [[72, "construct-a-regridder"]], "Constructing a sparse array": [[80, "constructing-a-sparse-array"]], "Contents": [[83, "contents"]], "Convert a single timestep to sparse": [[80, "convert-a-single-timestep-to-sparse"]], "Convert multiple timesteps to sparse": [[80, "convert-multiple-timesteps-to-sparse"]], "Convert the dataset into a dataframe": [[46, "convert-the-dataset-into-a-dataframe"]], "Convert to Dataframes": [[46, "convert-to-dataframes"]], "Converting to Standard Units": [[65, "converting-to-standard-units"]], "Copy the link from Github": [[50, "copy-the-link-from-github"]], "Correctly Calculating Annual Averages with Xarray": [[68, "correctly-calculating-annual-averages-with-xarray"]], "Covered in this tutorial": [[35, "covered-in-this-tutorial"]], "Create a dask cluster": [[87, "create-a-dask-cluster"]], "Create a docs directory": [[50, "create-a-docs-directory"]], "Create a helper function for generating a filepath": [[17, "create-a-helper-function-for-generating-a-filepath"]], "Create a helper function to split a dataset into sub-datasets": [[17, "create-a-helper-function-to-split-a-dataset-into-sub-datasets"]], "Create reference file for each netCDF file": [[84, "create-reference-file-for-each-netcdf-file"]], "Create sparse matrix map": [[83, "create-sparse-matrix-map"]], "Create the filesystem and mapper": [[86, "create-the-filesystem-and-mapper"]], "Create your Github Repository": [[50, "create-your-github-repository"]], "Creating Model Documentation Using Jupyterbook and Intake-esm": [[50, "creating-model-documentation-using-jupyterbook-and-intake-esm"]], "Creating Visualizations of Intake-ESM Catalogs": [[36, "creating-visualizations-of-intake-esm-catalogs"]], "Creating a new data pipeline": [[87, "creating-a-new-data-pipeline"]], "Creating and accessing a new conda environment on the NSF NCAR JupyterHub": [[7, "creating-and-accessing-a-new-conda-environment-on-the-nsf-ncar-jupyterhub"]], "Creating helper functions for plotting": [[39, "creating-helper-functions-for-plotting"]], "Creating our Derived Variable Registry": [[38, "creating-our-derived-variable-registry"]], "Dask": [[29, "dask"]], "Dask Distributed Summit 2021 Takeaways": [[25, "dask-distributed-summit-2021-takeaways"]], "Dask Questions": [[30, "dask-questions"], [31, "dask-questions"]], "Dask Tutorial": [[26, "dask-tutorial"]], "Dask Tutorial (14 July and 11 August 2021)": [[32, "dask-tutorial-14-july-and-11-august-2021"]], "Dask Tutorial UPDATED DATES": [[27, "dask-tutorial-updated-dates"]], "Dask on HPC Talk Links": [[25, "dask-on-hpc-talk-links"]], "Dask on High Performance Computing Systems": [[25, "dask-on-high-performance-computing-systems"]], "Data Access": [[32, "data-access"]], "Data Computation": [[30, "data-computation"], [31, "data-computation"], [32, "data-computation"]], "Data Operation": [[47, "data-operation"]], "Data Visualization": [[32, "data-visualization"]], "Datashader": [[23, "datashader"]], "Dealing with CESM monthly output - is there something wrong with time": [[7, "dealing-with-cesm-monthly-output-is-there-something-wrong-with-time"]], "Dealing with Relative vs. Absolute Paths": [[18, "dealing-with-relative-vs-absolute-paths"]], "Dealing with the time": [[65, "dealing-with-the-time"]], "Debugging Intake-ESM Process for Reading in CMIP6": [[42, "debugging-intake-esm-process-for-reading-in-cmip6"]], "Debugging dask workflows: Detrending": [[73, "debugging-dask-workflows-detrending"]], "Define a function that reads in map file (weights) and constructs a sparse array": [[83, "define-a-function-that-reads-in-map-file-weights-and-constructs-a-sparse-array"]], "Define a function to apply weights using this method": [[83, "define-a-function-to-apply-weights-using-this-method"]], "Define a function to remap using weights file": [[83, "define-a-function-to-remap-using-weights-file"]], "Define a helper function which subsets the data, groups by year, and returns the data array": [[37, "define-a-helper-function-which-subsets-the-data-groups-by-year-and-returns-the-data-array"]], "Define regridding function that constructs an xESMF regridder": [[83, "define-regridding-function-that-constructs-an-xesmf-regridder"]], "Demo: reading a dataset": [[86, "demo-reading-a-dataset"]], "Demonstration": [[81, "demonstration"]], "Determining the Cause of the Error": [[42, "determining-the-cause-of-the-error"]], "Diagnostic Efforts": [[93, "diagnostic-efforts"]], "Diagnostic Packages": [[29, "diagnostic-packages"]], "Discovery": [[63, "discovery"]], "Distributed client with adaptive scaling": [[83, "distributed-client-with-adaptive-scaling"]], "Documentation and Citations": [[32, "documentation-and-citations"]], "Download a sample CESM logo": [[50, "download-a-sample-cesm-logo"]], "Downloading the beta version of ecgtools": [[28, "downloading-the-beta-version-of-ecgtools"]], "ESDS Activities Calendar": [[6, "esds-activities-calendar"]], "ESDS Blog Contributors Guide": [[0, "esds-blog-contributors-guide"]], "ESDS Blog Posts": [[30, "esds-blog-posts"], [31, "esds-blog-posts"]], "ESDS Committees and Working Groups": [[2, "esds-committees-and-working-groups"]], "ESDS Forum": [[6, "esds-forum"], [30, "esds-forum"], [31, "esds-forum"]], "ESDS GitHub Repository": [[6, "esds-github-repository"]], "ESDS Office Hours Support": [[88, "esds-office-hours-support"]], "ESDS Progress Over the Past Few Months": [[32, "esds-progress-over-the-past-few-months"]], "ESDS Representatives": [[2, "esds-representatives"]], "ESDS Update November 2021": [[30, "esds-update-november-2021"]], "ESDS Update October 2021": [[31, "esds-update-october-2021"]], "ESDS and other NCAR/UCAR contributions:": [[89, "esds-and-other-ncar-ucar-contributions"]], "ESDS at SciPy 2023": [[89, "esds-at-scipy-2023"]], "Earth System Data Science (ESDS)": [[1, "earth-system-data-science-esds"]], "Earth System Data Science (ESDS) Initiative": [[8, "earth-system-data-science-esds-initiative"]], "Earth system model Catalog Generation Tools (ecgtools)": [[93, "earth-system-model-catalog-generation-tools-ecgtools"]], "Easy visualization": [[80, "easy-visualization"]], "Email List": [[6, "email-list"]], "End to End Workflow": [[30, "end-to-end-workflow"], [31, "end-to-end-workflow"], [32, "end-to-end-workflow"]], "Environment Install": [[75, "environment-install"]], "Esm_catalog_utils": [[93, "esm-catalog-utils"]], "Event Recordings": [[76, "event-recordings"]], "Events Working Group": [[2, "events-working-group"]], "Examine of the files": [[67, "examine-of-the-files"]], "Examining Diagnostics Using Intake-ESM and hvPlot": [[39, "examining-diagnostics-using-intake-esm-and-hvplot"]], "Example detrending operation": [[73, "example-detrending-operation"]], "Example of case visualization": [[36, "example-of-case-visualization"]], "Example using new Casper-batch login": [[22, "example-using-new-casper-batch-login"]], "Extract surface temperature variable (TS)": [[83, "extract-surface-temperature-variable-ts"]], "Extract the Grid Area and Compute the Total Area": [[46, "extract-the-grid-area-and-compute-the-total-area"]], "Fair Warning": [[50, "fair-warning"]], "Falko Judt (MMM):": [[90, "falko-judt-mmm"]], "Final Thoughts": [[71, "final-thoughts"]], "Finally": [[73, "finally"]], "First create a list of files": [[87, "first-create-a-list-of-files"]], "Fix the time on the observations": [[61, "fix-the-time-on-the-observations"]], "Foundations Book": [[59, "foundations-book"]], "Frequently Asked Questions": [[7, "frequently-asked-questions"]], "Funding": [[29, "funding"]], "Further reading": [[83, "further-reading"]], "Future work": [[73, "future-work"]], "Gather a list of files available from an Amazon s3 bucket": [[84, "gather-a-list-of-files-available-from-an-amazon-s3-bucket"]], "General Advice": [[7, "general-advice"]], "General Discussion": [[30, "general-discussion"], [31, "general-discussion"]], "General tips": [[7, "general-tips"]], "Generate references for the sfc and h datasets": [[86, "generate-references-for-the-sfc-and-h-datasets"]], "Generate the Mapper Files": [[84, "generate-the-mapper-files"]], "GeoCAT": [[93, "geocat"]], "GeoCAT Comp Tutorial (08 September 2021)": [[32, "geocat-comp-tutorial-08-september-2021"]], "GeoCAT Viz Tutorial (25 August 2021)": [[32, "geocat-viz-tutorial-25-august-2021"]], "GeoCAT-Comp Tutorial": [[33, "geocat-comp-tutorial"]], "GeoCAT-comp": [[93, "geocat-comp"]], "GeoCAT-examples": [[93, "geocat-examples"]], "GeoCAT-viz": [[93, "geocat-viz"]], "Geoviews": [[23, "geoviews"]], "Git and GitHub Tutorial": [[35, "git-and-github-tutorial"]], "Git and Github Tutorial (12 May 2021)": [[32, "git-and-github-tutorial-12-may-2021"]], "GitHub": [[7, "github"]], "Given that much of the diagnostic development comes from volunteers in the user community, how could you or your colleagues contribute": [[24, "given-that-much-of-the-diagnostic-development-comes-from-volunteers-in-the-user-community-how-could-you-or-your-colleagues-contribute"]], "Go checkout your book!": [[50, "go-checkout-your-book"]], "Goal": [[80, "goal"]], "Grab a list of files": [[67, "grab-a-list-of-files"]], "Grab some Observational Data": [[46, "grab-some-observational-data"]], "Growth and History of Anaconda + Numpy + SciPy + Dask": [[25, "growth-and-history-of-anaconda-numpy-scipy-dask"]], "Help topics:": [[7, "help-topics"]], "Help, my analysis is slow!": [[7, "help-my-analysis-is-slow"]], "Helper function to make all of the plots the same way but with different data": [[81, "helper-function-to-make-all-of-the-plots-the-same-way-but-with-different-data"]], "Helpful Templates": [[4, "helpful-templates"]], "HiRes-CESM Interactive Dashboard Example": [[18, "hires-cesm-interactive-dashboard-example"]], "Holoviews": [[23, "holoviews"]], "How can I export my environments?": [[7, "how-can-i-export-my-environments"]], "How can I use the new updates to NCAR-jobqueue?": [[52, "how-can-i-use-the-new-updates-to-ncar-jobqueue"]], "How can we tie this back to ESDS?": [[25, "how-can-we-tie-this-back-to-esds"]], "How could we better enable contributions?": [[24, "how-could-we-better-enable-contributions"]], "How do I debug my code when using Dask?": [[7, "how-do-i-debug-my-code-when-using-dask"]], "How do I mint a DOI for my repository if I am outside the NCAR organization?": [[64, "how-do-i-mint-a-doi-for-my-repository-if-i-am-outside-the-ncar-organization"]], "How do I optimize reading multiple files using Xarray and Dask?": [[7, "how-do-i-optimize-reading-multiple-files-using-xarray-and-dask"]], "How do I use conda environments?": [[7, "how-do-i-use-conda-environments"]], "How do we find these projects?": [[29, "how-do-we-find-these-projects"]], "How do you Incorporate Diagnostics within your Workflow?": [[24, "how-do-you-incorporate-diagnostics-within-your-workflow"]], "How else should I make sure people cite my software?": [[64, "how-else-should-i-make-sure-people-cite-my-software"]], "How is NCAR-Jobqueue different than Dask-Jobqueue": [[52, "how-is-ncar-jobqueue-different-than-dask-jobqueue"]], "How to Parameterize Notebooks": [[44, "how-to-parameterize-notebooks"]], "How to Use xarray.map_blocks for Vertical Interpolation of a 3D Field": [[47, "how-to-use-xarray-map-blocks-for-vertical-interpolation-of-a-3d-field"]], "How to add a Derived Variable": [[38, "how-to-add-a-derived-variable"]], "How to use Papermill": [[71, "how-to-use-papermill"]], "How would I use this on within my workflow on Casper?": [[52, "how-would-i-use-this-on-within-my-workflow-on-casper"]], "How-to-Run": [[40, "how-to-run"], [56, "how-to-run"], [70, "how-to-run"], [78, "how-to-run"], [82, "how-to-run"]], "I have to do lots of rechunking, but the rechunk step uses too much memory and kills my workers.": [[7, "i-have-to-do-lots-of-rechunking-but-the-rechunk-step-uses-too-much-memory-and-kills-my-workers"]], "Importing Libraries": [[80, "importing-libraries"]], "Imports": [[20, "imports"], [23, "imports"], [28, "imports"], [36, "imports"], [37, "imports"], [38, "imports"], [39, "imports"], [41, "imports"], [46, "imports"], [50, "imports"], [61, "imports"], [65, "imports"], [67, "imports"], [68, "imports"], [81, "imports"], [83, "imports"], [84, "imports"]], "Imports and Data Ingestion": [[47, "imports-and-data-ingestion"]], "Indexing unstructured grids with the Power of Xoak": [[51, "indexing-unstructured-grids-with-the-power-of-xoak"]], "Inheritance": [[15, "inheritance"]], "Inlining data": [[86, "inlining-data"]], "Inspect the Catalog": [[28, "inspect-the-catalog"]], "Install Github Pages Import": [[50, "install-github-pages-import"]], "Installing packages via conda-forge": [[20, "installing-packages-via-conda-forge"]], "Installing the Development Version of Intake-ESM": [[38, "installing-the-development-version-of-intake-esm"]], "Installing xwrf": [[67, "installing-xwrf"]], "Instead use opt_einsum": [[83, "instead-use-opt-einsum"]], "Intake-ESM Tutorial": [[40, "intake-esm-tutorial"]], "Intake-esm": [[93, "intake-esm"]], "Interactive Computing": [[29, "interactive-computing"]], "Intercomparison of History": [[20, "intercomparison-of-history"]], "Intercomparison of Timeseries": [[20, "intercomparison-of-timeseries"]], "Interpolate Vertical Levels": [[61, "interpolate-vertical-levels"]], "Introduction": [[46, "introduction"]], "Introduction + What/Why Dask": [[62, "introduction-what-why-dask"]], "Introduction to Distributed Computing": [[62, "introduction-to-distributed-computing"]], "Introduction to sparse arrays": [[80, "introduction-to-sparse-arrays"]], "Investigate the Data": [[67, "investigate-the-data"]], "Investigate the File Structure and Sample Dataset": [[41, "investigate-the-file-structure-and-sample-dataset"]], "Investigate the Variables": [[67, "investigate-the-variables"]], "Investigate the Vertical Levels": [[67, "investigate-the-vertical-levels"]], "Invited Talk": [[92, "invited-talk"]], "Invoke xr.save_mfdataset()": [[17, "invoke-xr-save-mfdataset"]], "Is it fixed?": [[73, "is-it-fixed"]], "Jinja2": [[15, "jinja2"]], "Jinja2 Statements": [[15, "jinja2-statements"]], "Jupyter Notebooks Tutorial FAQ": [[45, "jupyter-notebooks-tutorial-faq"]], "Katie Dagon (CGD):": [[90, "katie-dagon-cgd"]], "Keynote - Fernando Perez - SciPy and Open Source Toolsin Sicence: Challenges and Successes": [[63, "keynote-fernando-perez-scipy-and-open-source-toolsin-sicence-challenges-and-successes"]], "KilledWorker X{. What do I do?": [[7, "killedworker-x-what-do-i-do"]], "Leadership Committee": [[2, "leadership-committee"]], "Learning Resources": [[6, "learning-resources"]], "Lets look at detrend": [[73, "lets-look-at-detrend"]], "Let\u2019s look at polyfit again": [[73, "let-s-look-at-polyfit-again"]], "Load in our computation": [[39, "load-in-our-computation"]], "Load in our datasets using .to_dataset_dict()": [[46, "load-in-our-datasets-using-to-dataset-dict"]], "Load in the CESM2-LE Data": [[68, "load-in-the-cesm2-le-data"]], "Load some toy dataset": [[17, "load-some-toy-dataset"]], "Local Install": [[75, "local-install"]], "Look at one of the datasets": [[37, "look-at-one-of-the-datasets"]], "Looking at the Dashboard": [[62, "looking-at-the-dashboard"]], "Looping through the CESM-LE catalog": [[36, "looping-through-the-cesm-le-catalog"]], "Main Challenge": [[37, "main-challenge"]], "Main Takeaways from the Discussion": [[24, "main-takeaways-from-the-discussion"]], "Main \u201ccomponents\u201d of Graphviz": [[36, "main-components-of-graphviz"]], "Make a test plot": [[80, "make-a-test-plot"]], "Make source / destination grids": [[83, "make-source-destination-grids"]], "Managing Computational Resources": [[4, "managing-computational-resources"]], "Many xarray operations just work": [[80, "many-xarray-operations-just-work"]], "Matplotlib Questions": [[30, "matplotlib-questions"], [31, "matplotlib-questions"]], "Matplotlib Tutorial": [[49, "matplotlib-tutorial"]], "Matplotlib Tutorial (24 March 2021)": [[32, "matplotlib-tutorial-24-march-2021"]], "Matplotlib Tutorial FAQ": [[48, "matplotlib-tutorial-faq"]], "Membership & Participation": [[6, "membership-participation"]], "Merge the reference files together": [[84, "merge-the-reference-files-together"]], "MetPy Tutorial": [[78, "metpy-tutorial"]], "Modify the Time values as well\u2026": [[67, "modify-the-time-values-as-well"]], "Modular Ocean Model (MOM6)-tools": [[93, "modular-ocean-model-mom6-tools"]], "My Dask workers are taking a long time to start. How can I monitor them?": [[7, "my-dask-workers-are-taking-a-long-time-to-start-how-can-i-monitor-them"]], "NCAR-CGD ESDS Town Hall": [[29, "ncar-cgd-esds-town-hall"]], "NCAR-Jobqueue": [[52, "ncar-jobqueue"]], "NPL on the NSF NCAR JupyterHub": [[7, "npl-on-the-nsf-ncar-jupyterhub"]], "NPL on the command line": [[7, "npl-on-the-command-line"]], "NSF NCAR HPC Best Practices": [[4, "nsf-ncar-hpc-best-practices"]], "Nbscuid": [[93, "nbscuid"]], "Near-term Goals": [[2, "near-term-goals"]], "New Insights": [[63, "new-insights"]], "New Office Hours Appointment System": [[79, "new-office-hours-appointment-system"]], "Next": [[86, "next"]], "Note that on-disk chunking matters": [[87, "note-that-on-disk-chunking-matters"]], "NumPy Tutorial FAQ": [[53, "numpy-tutorial-faq"]], "Numpy Tutorial": [[54, "numpy-tutorial"]], "Numpy Tutorial (10 March 2021)": [[32, "numpy-tutorial-10-march-2021"]], "OCEtrac - Ocetrac: morphological image processing for monitoring marine heatwaves": [[63, "ocetrac-ocetrac-morphological-image-processing-for-monitoring-marine-heatwaves"]], "Object Oriented Programming Tutorial": [[30, "object-oriented-programming-tutorial"], [55, "object-oriented-programming-tutorial"], [56, "object-oriented-programming-tutorial"]], "Object Oriented Programming Tutorial (09 April 2021)": [[32, "object-oriented-programming-tutorial-09-april-2021"]], "Office Hour Questions": [[30, "office-hour-questions"], [31, "office-hour-questions"]], "Office Hours": [[6, "office-hours"], [9, "office-hours"], [32, "office-hours"]], "Option 1: from the command line": [[71, "option-1-from-the-command-line"]], "Option 2: from another Python script or Jupyter notebook": [[71, "option-2-from-another-python-script-or-jupyter-notebook"]], "Organization": [[6, "organization"]], "Orhan Eroglu (CISL):": [[90, "orhan-eroglu-cisl"]], "Over-arching Comments": [[24, "over-arching-comments"]], "Overall Design": [[29, "overall-design"]], "Overview": [[83, "overview"], [92, "overview"]], "Overview of CESM Workshop": [[24, "overview-of-cesm-workshop"]], "Overview of Dask and Dashboards": [[62, "overview-of-dask-and-dashboards"]], "Overview of the Cluster": [[62, "overview-of-the-cluster"]], "Package Template": [[4, "package-template"]], "Package imports": [[17, "package-imports"]], "Paired Programming using VS Code": [[57, "paired-programming-using-vs-code"]], "Pandas Tutorial": [[58, "pandas-tutorial"]], "Pandas Tutorial (26 May 2021)": [[32, "pandas-tutorial-26-may-2021"]], "Pangeo Session": [[25, "pangeo-session"]], "Pangeo Session Talk Links": [[25, "pangeo-session-talk-links"]], "Parallel Ocean Program (POP)-tools": [[93, "parallel-ocean-program-pop-tools"]], "Parallel Writing/Zarr": [[29, "parallel-writing-zarr"]], "Parameterizing Code Cells": [[44, "parameterizing-code-cells"]], "Parameterizing Markdown Cells": [[44, "parameterizing-markdown-cells"]], "Part 1": [[32, "part-1"], [32, "id1"]], "Part 2": [[32, "part-2"], [32, "id2"]], "Past Committee Members": [[2, "past-committee-members"]], "Perform a computation on input dataset": [[17, "perform-a-computation-on-input-dataset"]], "Plan": [[90, "plan"]], "Please join us (virtually) on the following dates:": [[60, "please-join-us-virtually-on-the-following-dates"]], "Please show me the code": [[17, "please-show-me-the-code"]], "Plot CESM2-LE Temperature Climatologies": [[41, "plot-cesm2-le-temperature-climatologies"]], "Plot Monthly Temperature Climatologies from Observations": [[41, "plot-monthly-temperature-climatologies-from-observations"]], "Plot Observational Temperature Climatologies": [[41, "plot-observational-temperature-climatologies"]], "Plot Seasonal Temperature Climatologies from Observations": [[41, "plot-seasonal-temperature-climatologies-from-observations"]], "Plot a Comparison of Wall time for Different Computations": [[20, "plot-a-comparison-of-wall-time-for-different-computations"]], "Plot a Comparison using Holoviews": [[39, "plot-a-comparison-using-holoviews"]], "Plot an Interactive Map using hvPlot": [[61, "plot-an-interactive-map-using-hvplot"]], "Plot our Results!": [[37, "plot-our-results"]], "Plot our final comparisons": [[39, "plot-our-final-comparisons"]], "Plot the Output": [[38, "plot-the-output"], [46, "plot-the-output"]], "Plot the Output using hvPlot": [[67, "plot-the-output-using-hvplot"]], "Plot the output from the Mapper Method": [[84, "plot-the-output-from-the-mapper-method"]], "Plot the result using Datashader + Geoviews/Holoviews": [[23, "plot-the-result-using-datashader-geoviews-holoviews"]], "Plot up the Monthly Mean Temperature": [[41, "plot-up-the-monthly-mean-temperature"]], "Plot up the Seasonal Mean Temperature": [[41, "plot-up-the-seasonal-mean-temperature"]], "Plotting CESM Data on an Unstructured Grid using Geoviews and Datashader": [[23, "plotting-cesm-data-on-an-unstructured-grid-using-geoviews-and-datashader"]], "Plotting an Interactive Meteogram": [[65, "plotting-an-interactive-meteogram"]], "Plotting with GeoCAT Tutorial": [[34, "plotting-with-geocat-tutorial"]], "Pop-Tools": [[29, "pop-tools"]], "Possible improvements": [[72, "possible-improvements"]], "Posters:": [[89, "posters"]], "Potential opportunities for improvements": [[47, "potential-opportunities-for-improvements"]], "Preparation": [[19, "preparation"], [21, "preparation"], [26, "preparation"], [27, "preparation"], [33, "preparation"], [34, "preparation"], [49, "preparation"], [54, "preparation"], [55, "preparation"], [58, "preparation"], [66, "preparation"]], "Preparation before tutorial": [[35, "preparation-before-tutorial"]], "Preparation for a (Re)Introduction to Earth System Data Science (ESDS) Across NCAR/UCAR/UCP": [[75, "preparation-for-a-re-introduction-to-earth-system-data-science-esds-across-ncar-ucar-ucp"]], "Presentation Slides": [[76, "presentation-slides"]], "Processing Data from the NCAR Mesa Lab Weather Station": [[65, "processing-data-from-the-ncar-mesa-lab-weather-station"]], "Project Pythia": [[6, "project-pythia"]], "Project Pythia Portal Overview": [[59, "project-pythia-portal-overview"]], "Projects": [[93, "projects"]], "Publications and Citations": [[29, "publications-and-citations"]], "Putting it all together": [[80, "putting-it-all-together"]], "Python Package Overviews": [[30, "python-package-overviews"], [31, "python-package-overviews"], [32, "python-package-overviews"]], "Python Tutorial FAQ": [[12, "python-tutorial-faq"]], "Python Tutorial FAQ - Part 2": [[13, "python-tutorial-faq-part-2"]], "Python Tutorial FAQ - Part 3": [[14, "python-tutorial-faq-part-3"]], "Python Tutorial Seminar Series - Spring 2021": [[60, "python-tutorial-seminar-series-spring-2021"]], "Python Tutorial(s)": [[30, "python-tutorial-s"], [31, "python-tutorial-s"]], "Python Tutorials": [[32, "python-tutorials"]], "Query and Subset our Catalog": [[37, "query-and-subset-our-catalog"]], "Query for monthly temperature (T) values, using the historical experiment": [[41, "query-for-monthly-temperature-t-values-using-the-historical-experiment"]], "Querying for our desired variable": [[37, "querying-for-our-desired-variable"]], "Question": [[80, "question"]], "Question and Answer Portion": [[29, "question-and-answer-portion"]], "Read": [[87, "read"]], "Read and concatenate the whole dataset": [[87, "read-and-concatenate-the-whole-dataset"]], "Read data": [[72, "read-data"]], "Read directly from S3 (without kerchunk)": [[84, "read-directly-from-s3-without-kerchunk"]], "Read in CAM-SE output": [[83, "read-in-cam-se-output"], [83, "id1"], [83, "id4"], [83, "id6"]], "Read in CESM Output": [[41, "read-in-cesm-output"]], "Read in Data": [[46, "read-in-data"]], "Read in Data with our Registry": [[38, "read-in-data-with-our-registry"]], "Read in Model Data": [[61, "read-in-model-data"]], "Read in Observational Data from the Catalog": [[41, "read-in-observational-data-from-the-catalog"]], "Read in Observational Data from the World Ocean Atlas": [[61, "read-in-observational-data-from-the-world-ocean-atlas"]], "Read in a dictionary of datasets": [[39, "read-in-a-dictionary-of-datasets"]], "Read in and format data": [[81, "read-in-and-format-data"]], "Read in intake-esm catalog": [[36, "read-in-intake-esm-catalog"]], "Read in map file (weights)": [[83, "read-in-map-file-weights"], [83, "id2"]], "Read in the CSV File Containing Metadata": [[18, "read-in-the-csv-file-containing-metadata"]], "Read in the Data using Xarray": [[61, "read-in-the-data-using-xarray"]], "Read in the Dataset": [[67, "read-in-the-dataset"]], "Read in the Grid Data": [[46, "read-in-the-grid-data"]], "Read in the Test History Catalog": [[50, "read-in-the-test-history-catalog"]], "Read in the data": [[23, "read-in-the-data"], [39, "read-in-the-data"]], "Read in the data catalog": [[37, "read-in-the-data-catalog"]], "Read in using .to_dataset_dict()": [[37, "read-in-using-to-dataset-dict"]], "Read in weights": [[83, "read-in-weights"]], "Read the CESM-LE data": [[43, "read-the-cesm-le-data"]], "Read the Catalog and Visualize the Components and Frequency": [[50, "read-the-catalog-and-visualize-the-components-and-frequency"]], "Read the Catalogs Using Intake-ESM": [[20, "read-the-catalogs-using-intake-esm"]], "Read the weights file": [[72, "read-the-weights-file"]], "Reading WRF data into Xarray and Visualizing the Output using hvPlot": [[67, "reading-wrf-data-into-xarray-and-visualizing-the-output-using-hvplot"]], "Reading the combined dataset": [[86, "reading-the-combined-dataset"]], "Rebuilding your book": [[50, "rebuilding-your-book"]], "Recap": [[90, "recap"]], "Recap of a (Re)Introduction to Earth System Data Science (ESDS) Across NCAR/UCAR/UCP": [[76, "recap-of-a-re-introduction-to-earth-system-data-science-esds-across-ncar-ucar-ucp"]], "Recap: Unstructured Grid Collaborative Work Time": [[90, "recap-unstructured-grid-collaborative-work-time"]], "Recent posts": [[8, "recent-posts"]], "Registration": [[91, "registration"]], "Regrid and Interpolate Vertical Levels": [[61, "regrid-and-interpolate-vertical-levels"]], "Regrid using xESMF": [[61, "regrid-using-xesmf"]], "Regridding High Resolution Observations to a High Resolution Model Grid": [[61, "regridding-high-resolution-observations-to-a-high-resolution-model-grid"]], "Regridding using xESMF and an existing weights file": [[72, "regridding-using-xesmf-and-an-existing-weights-file"]], "Regridding with xESMF": [[72, "regridding-with-xesmf"]], "Reimagining Diagnostics Through the Use of the Jupyter Ecosystem": [[44, "reimagining-diagnostics-through-the-use-of-the-jupyter-ecosystem"]], "Reproducing the Error": [[42, "reproducing-the-error"]], "Reshape 1-D vector to destination grid": [[83, "reshape-1-d-vector-to-destination-grid"]], "Reshape destination grid to build structured data array": [[83, "reshape-destination-grid-to-build-structured-data-array"]], "Resource Gallery": [[59, "resource-gallery"]], "Resources": [[92, "resources"]], "Resources Guide": [[76, "resources-guide"]], "Run the Dashboard Inline": [[18, "run-the-dashboard-inline"]], "Running this": [[63, "running-this"]], "Running this on the Entire Dataset": [[47, "running-this-on-the-entire-dataset"]], "Save the Catalog": [[28, "save-the-catalog"]], "Save the Visualization": [[50, "save-the-visualization"]], "Save the catalog": [[41, "save-the-catalog"]], "Save the catalog locally": [[20, "save-the-catalog-locally"], [20, "id1"]], "Saving data": [[62, "saving-data"]], "Scaling Python with Dask Class Takeaways": [[62, "scaling-python-with-dask-class-takeaways"]], "SciPy Conference 2021 Takeaways": [[63, "scipy-conference-2021-takeaways"]], "Search for Just Monthly Ocean Output": [[20, "search-for-just-monthly-ocean-output"]], "Search for your problem": [[74, "search-for-your-problem"]], "Session homework": [[75, "session-homework"]], "Set CAM-SE output location and map file": [[83, "set-cam-se-output-location-and-map-file"]], "Setting up GitHub Authentication": [[7, "setting-up-github-authentication"]], "Setting up an Analysis Configuration File": [[44, "setting-up-an-analysis-configuration-file"]], "Setting up our Jupyter Book Table of Contents": [[44, "setting-up-our-jupyter-book-table-of-contents"]], "Setting up the imports/dask": [[43, "setting-up-the-imports-dask"]], "Setting up the \u201cPreprocessing\u201d Notebooks": [[44, "setting-up-the-preprocessing-notebooks"]], "Setup": [[73, "setup"], [86, "setup"]], "Setup our Temperature Plots": [[65, "setup-our-temperature-plots"]], "Setup our Wind Plots": [[65, "setup-our-wind-plots"]], "Setup the Computation - Below, we lazily prepare the calculation!": [[46, "setup-the-computation-below-we-lazily-prepare-the-calculation"]], "Setup the traiangulate function, described in the datashader.Trimesh documentation": [[23, "setup-the-traiangulate-function-described-in-the-datashader-trimesh-documentation"]], "Shifting Landscape of Technical Tools": [[29, "shifting-landscape-of-technical-tools"]], "Sign Up": [[16, "sign-up"], [19, "sign-up"], [21, "sign-up"], [26, "sign-up"], [27, "sign-up"], [33, "sign-up"], [34, "sign-up"], [35, "sign-up"], [40, "sign-up"], [49, "sign-up"], [54, "sign-up"], [55, "sign-up"], [56, "sign-up"], [58, "sign-up"], [60, "sign-up"], [66, "sign-up"], [70, "sign-up"], [78, "sign-up"], [82, "sign-up"]], "Simple example: generate references for the static file": [[86, "simple-example-generate-references-for-the-static-file"]], "Simple xarray.open_dataset": [[86, "simple-xarray-open-dataset"]], "So what\u2019s the difference?": [[81, "so-what-s-the-difference"]], "Software Design": [[4, "software-design"]], "Software Engineering Working Group Meeting": [[24, "software-engineering-working-group-meeting"]], "Someone must have written the function I want. Where do I look?": [[7, "someone-must-have-written-the-function-i-want-where-do-i-look"]], "Sparse arrays and the CESM land model component": [[80, "sparse-arrays-and-the-cesm-land-model-component"]], "Sparse arrays with dask": [[80, "sparse-arrays-with-dask"]], "Sparse arrays with dask + xarray": [[80, "sparse-arrays-with-dask-xarray"]], "Spin Down the Cluster": [[46, "spin-down-the-cluster"]], "Spin up Dask Cluster": [[43, "spin-up-dask-cluster"]], "Spin up a Cluster": [[46, "spin-up-a-cluster"], [67, "spin-up-a-cluster"], [68, "spin-up-a-cluster"], [83, "spin-up-a-cluster"], [84, "spin-up-a-cluster"]], "Spin up a Dask Cluster": [[20, "spin-up-a-dask-cluster"], [38, "spin-up-a-dask-cluster"], [39, "spin-up-a-dask-cluster"]], "Spin up our Dask Cluster": [[37, "spin-up-our-dask-cluster"]], "Start Learning": [[59, "start-learning"]], "Start by opening a single file": [[87, "start-by-opening-a-single-file"]], "Step 1: Prepare the notebook": [[71, "step-1-prepare-the-notebook"]], "Step 2: Prepare the execution environment": [[71, "step-2-prepare-the-execution-environment"]], "Step 3: Running the notebook": [[71, "step-3-running-the-notebook"]], "Steps to Create Your Own Office Hours Appointment": [[88, "steps-to-create-your-own-office-hours-appointment"]], "Subset for Daily Temperature Data (TREFHT)": [[46, "subset-for-daily-temperature-data-trefht"]], "Subset for monthly output from the last 20 years": [[39, "subset-for-monthly-output-from-the-last-20-years"]], "Subset for time - here, we are interested in year 24 through 53": [[61, "subset-for-time-here-we-are-interested-in-year-24-through-53"]], "Summary": [[73, "summary"], [73, "id1"], [80, "summary"], [83, "summary"], [84, "summary"], [86, "summary"]], "Summary of the timing test:": [[83, "summary-of-the-timing-test"]], "Take a Look at the Difference": [[68, "take-a-look-at-the-difference"]], "Takeaways": [[90, "takeaways"]], "Taking a Look at the Interactive Plots": [[44, "taking-a-look-at-the-interactive-plots"]], "Talk to yourself": [[74, "talk-to-yourself"]], "Talks": [[89, "talks"]], "Templating isn\u2019t just for Web Developers!": [[15, "templating-isn-t-just-for-web-developers"]], "Test File Access Speeds": [[20, "test-file-access-speeds"]], "Test out the History Files": [[20, "test-out-the-history-files"]], "Test out the Timeseries Files": [[20, "test-out-the-timeseries-files"]], "Test with a small subset": [[87, "test-with-a-small-subset"]], "The Case for cftime.DatetimeNoLeap": [[11, "the-case-for-cftime-datetimenoleap"]], "The Case for datetime64": [[11, "the-case-for-datetime64"]], "The Data": [[65, "the-data"], [68, "the-data"]], "The Importance of Software Citation": [[64, "the-importance-of-software-citation"]], "The Jinja2 Template": [[15, "the-jinja2-template"]], "The Letter": [[15, "the-letter"]], "The Pangeo-Forge Method": [[61, "the-pangeo-forge-method"]], "The Problem": [[65, "the-problem"], [68, "the-problem"]], "The Pythia Portal": [[59, "the-pythia-portal"]], "The Python Tutorial Series Returns this Summer!": [[82, "the-python-tutorial-series-returns-this-summer"]], "The Significance of Time": [[11, "the-significance-of-time"]], "The Solution": [[65, "the-solution"], [68, "the-solution"]], "The Task": [[11, "the-task"]], "The Temptation": [[11, "the-temptation"]], "The Tribulation": [[11, "the-tribulation"]], "The Use Case": [[15, "the-use-case"]], "The best of both worlds": [[11, "the-best-of-both-worlds"]], "The correct way to compute seasonal averages with xarray": [[81, "the-correct-way-to-compute-seasonal-averages-with-xarray"]], "The incorrect way to compute seasonal averages from monthly data": [[81, "the-incorrect-way-to-compute-seasonal-averages-from-monthly-data"]], "Themes from the Diagnostic Discussion": [[24, "themes-from-the-diagnostic-discussion"]], "Thinking through CESM data access": [[87, "thinking-through-cesm-data-access"]], "Tidy Geospatial Cubes": [[89, "tidy-geospatial-cubes"]], "Timing performance for core multiply-add": [[83, "timing-performance-for-core-multiply-add"]], "Tips for building the site locally": [[1, "tips-for-building-the-site-locally"]], "Transparency of Models and Data": [[29, "transparency-of-models-and-data"]], "Trust your intuition": [[74, "trust-your-intuition"]], "Try preprocessing the dataset to make it work better": [[87, "try-preprocessing-the-dataset-to-make-it-work-better"]], "Tutorial Recording": [[40, "tutorial-recording"]], "Tutorial Seminar Series": [[16, "tutorial-seminar-series"]], "Tutorials": [[89, "tutorials"], [92, "tutorials"]], "UXarray": [[93, "uxarray"]], "Understanding the Directory Structure": [[28, "understanding-the-directory-structure"]], "Understanding the references dictionary": [[86, "understanding-the-references-dictionary"]], "Usability of Tools": [[29, "usability-of-tools"]], "Use ecgtools to build the catalog": [[41, "use-ecgtools-to-build-the-catalog"]], "Use the Intake-ESM Catalog to Access the Data": [[46, "use-the-intake-esm-catalog-to-access-the-data"]], "Use the catalog to read in data": [[28, "use-the-catalog-to-read-in-data"]], "Using Dask on the New Casper PBS Scheduler": [[22, "using-dask-on-the-new-casper-pbs-scheduler"]], "Using Graphviz in a Jupyter Notebook": [[36, "using-graphviz-in-a-jupyter-notebook"]], "Using Intake-ESM to Analyze Data from CESM2-LE": [[37, "using-intake-esm-to-analyze-data-from-cesm2-le"]], "Using Intake-ESM\u2019s New Derived Variable Functionality": [[38, "using-intake-esm-s-new-derived-variable-functionality"]], "Using conda on NSF NCAR HPC resources": [[7, "using-conda-on-nsf-ncar-hpc-resources"]], "Using datatree": [[86, "using-datatree"]], "Using our Configuration File in the Notebooks": [[44, "using-our-configuration-file-in-the-notebooks"]], "Using the Catalog": [[28, "using-the-catalog"], [37, "using-the-catalog"]], "Using xarray.apply_ufunc": [[80, "using-xarray-apply-ufunc"]], "Utilities": [[86, "utilities"]], "Values": [[2, "values"]], "View the Book on Github": [[50, "view-the-book-on-github"]], "Virtual aggregate CESM MOM6 datasets with kerchunk": [[86, "virtual-aggregate-cesm-mom6-datasets-with-kerchunk"]], "Vision": [[2, "vision"]], "Visualize": [[72, "visualize"], [83, "visualize"], [83, "id3"], [83, "id5"], [83, "id7"], [83, "id8"]], "Visualize the Catalog": [[50, "visualize-the-catalog"]], "Visualize the Comparisons": [[20, "visualize-the-comparisons"]], "Visualize the Output": [[47, "visualize-the-output"]], "Want to Create a New Appointment Type?": [[88, "want-to-create-a-new-appointment-type"]], "We are Xdev!": [[10, "we-are-xdev"]], "What Diagnostic Package(s) do you Use?": [[24, "what-diagnostic-package-s-do-you-use"]], "What I\u2019ve learned about debugging": [[74, "what-ive-learned-about-debugging"]], "What do I do if my question is not answered on this page?": [[7, "what-do-i-do-if-my-question-is-not-answered-on-this-page"]], "What exactly is xwrf?": [[67, "what-exactly-is-xwrf"]], "What features do you think are required before you would use new diagnostic packages?": [[24, "what-features-do-you-think-are-required-before-you-would-use-new-diagnostic-packages"]], "What is Papermill?": [[71, "what-is-papermill"]], "What is a sparse array?": [[80, "what-is-a-sparse-array"]], "What is a \u201cDerived Variable\u201d": [[38, "what-is-a-derived-variable"]], "What is it?": [[91, "what-is-it"]], "What is kerchunk?": [[86, "what-is-kerchunk"]], "What we learned": [[81, "what-we-learned"]], "What\u2019s a \u201chistory\u201d file?": [[28, "what-s-a-history-file"]], "Where can I find Xarray tutorials?": [[7, "where-can-i-find-xarray-tutorials"]], "Where do I go for help?": [[7, "where-do-i-go-for-help"]], "Who should attend?": [[91, "who-should-attend"]], "Why Jupyter": [[44, "why-jupyter"]], "Why would I want a DOI?": [[64, "why-would-i-want-a-doi"]], "Work in Progress Talks": [[32, "work-in-progress-talks"]], "Workflow Examples": [[32, "workflow-examples"]], "Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations": [[91, "workshop-from-jupyter-notebook-to-web-server-containerizing-interactive-visualizations"]], "Wrap it Up into a Function": [[68, "wrap-it-up-into-a-function"]], "Wrap it up": [[72, "wrap-it-up"]], "Wrapping into a Function and Using as a Preprocessor": [[65, "wrapping-into-a-function-and-using-as-a-preprocessor"]], "Wrapping sparse arrays in xarray": [[80, "wrapping-sparse-arrays-in-xarray"]], "Write the dataset to disk": [[43, "write-the-dataset-to-disk"]], "Writing multiple netCDF files in parallel with xarray and dask": [[17, "writing-multiple-netcdf-files-in-parallel-with-xarray-and-dask"]], "Writing to files in parallel": [[7, "writing-to-files-in-parallel"]], "Xarray + Dask Best Practices": [[62, "xarray-dask-best-practices"]], "Xarray Questions": [[30, "xarray-questions"], [31, "xarray-questions"]], "Xarray Tutorial": [[66, "xarray-tutorial"]], "Xarray Tutorial (09 and 23 June 2021)": [[32, "xarray-tutorial-09-and-23-june-2021"]], "Xarray User Forum + Updates": [[25, "xarray-user-forum-updates"]], "Xarray User Forum Talk Links": [[25, "xarray-user-forum-talk-links"]], "Xarray and Dask": [[7, "xarray-and-dask"]], "Xarray with GPUs": [[89, "xarray-with-gpus"]], "Xarray: Friendly, Interactive, and Scalable Scientific Data Analysis": [[89, "xarray-friendly-interactive-and-scalable-scientific-data-analysis"]], "Xdev Updates": [[30, "xdev-updates"], [31, "xdev-updates"]], "Your First Package Python Tutorial FAQ": [[69, "your-first-package-python-tutorial-faq"]], "Zen of Scientific Computing": [[4, "zen-of-scientific-computing"]], "Zulip": [[6, "zulip"]], "\u201cThinking with Xarray\u201d Tutorial": [[70, "thinking-with-xarray-tutorial"]]}, "docnames": ["CONTRIBUTING", "README", "about", "accessibility", "best-practices", "blog", "communication", "faq", "index", "office-hours", "posts/2019/we-are-xdev", "posts/2020/Time", "posts/2020/python-tutorial-faq", "posts/2020/python-tutorial-faq-part-2", "posts/2020/python-tutorial-faq-part-3", "posts/2020/templating-isnt-just-for-web-developers", "posts/2020/tutorial-seminar-series", "posts/2020/writing-multiple-netcdf-files-in-parallel-with-xarray-and-dask", "posts/2021/Interactive_Dashboard", "posts/2021/advanced-plotting-tutorial", "posts/2021/benchmarking-history-timeseries-intake", "posts/2021/cartopy-tutorial", "posts/2021/casper_pbs_dask", "posts/2021/cesm-datashader", "posts/2021/cesm-workshop-2021-diagnostics", "posts/2021/dask-summit-takeaway", "posts/2021/dask-tutorial", "posts/2021/dask-tutorial-update", "posts/2021/ecgtools-history-files-example", "posts/2021/esds-blog", "posts/2021/esds-update-november-2021", "posts/2021/esds-update-october-2021", "posts/2021/esds-update-september-2021", "posts/2021/geocat-comp-tutorial", "posts/2021/geocat-tutorial", "posts/2021/git-and-github-tutorial", "posts/2021/graphviz_example", "posts/2021/intake-cesm2-le-glade-example", "posts/2021/intake-esm-derived-variables", "posts/2021/intake-esm-holoviews-diagnostics", "posts/2021/intake-esm-tutorial-2021", "posts/2021/intake-obs-cesm2le-comparison", "posts/2021/intake_cmip6_debug", "posts/2021/intake_esm_dask", "posts/2021/jupyter-based-diagnostics-overview", "posts/2021/jupyter-notebooks-faq", "posts/2021/kay-et-al-cesm2-le", "posts/2021/map_blocks_example", "posts/2021/matplotlib-faq", "posts/2021/matplotlib-tutorial", "posts/2021/model_documentation_jupyterbook", "posts/2021/multiple_index_xarray_xoak", "posts/2021/ncar-jobqueue-example", "posts/2021/numpy-faq", "posts/2021/numpy-tutorial", "posts/2021/object-oriented-programming-tutorial", "posts/2021/oop-tutorial", "posts/2021/paired_programming_vs", "posts/2021/pandas-tutorial", "posts/2021/project-pythia-overview", "posts/2021/python-tutorial-seminar-series-spring-2021", "posts/2021/regrid-observations-pop-grid", "posts/2021/scaling-with-dask-class-takeaways", "posts/2021/scipy-2021-takeaways", "posts/2021/software-citation", "posts/2021/weather-station-data-preprocess", "posts/2021/xarray-tutorial", "posts/2021/xarray-wrf-example", "posts/2021/yearly-averages-xarray", "posts/2021/your-first-package-python-tutorial-faq", "posts/2022/Thinking-with-Xarray", "posts/2022/batch-processing-notebooks-with-papermill", "posts/2022/cam-se-regridding", "posts/2022/dask-debug-detrend", "posts/2022/debugging", "posts/2022/esds-event-prep", "posts/2022/esds-event-recap", "posts/2022/esds-fall-event", "posts/2022/metpy_tutorial", "posts/2022/office-hours-appointments", "posts/2022/sparse-PFT-gridding", "posts/2022/xarray-groupby-vs-geocat-climatology", "posts/2022/yourfirst", "posts/2023/cam-se-analysis", "posts/2023/cesm2-le-timeseries-kerchunk", "posts/2023/esds-annual-event", "posts/2023/kerchunk-mom6", "posts/2023/mfdataset", "posts/2023/office-hours-help", "posts/2023/scipy23", "posts/2023/unstructured-grid-collab-1", "posts/2024/containerize-visualizations-event", "posts/2024/esds-annual-event-recap", "projects"], "envversion": {"sphinx": 61, "sphinx.domains.c": 3, "sphinx.domains.changeset": 1, "sphinx.domains.citation": 1, "sphinx.domains.cpp": 9, "sphinx.domains.index": 1, "sphinx.domains.javascript": 3, "sphinx.domains.math": 2, "sphinx.domains.python": 4, "sphinx.domains.rst": 2, "sphinx.domains.std": 2}, "filenames": ["CONTRIBUTING.md", "README.md", "about.md", "accessibility.md", "best-practices.md", "blog.md", "communication.md", "faq.md", "index.md", "office-hours.md", "posts/2019/we-are-xdev.md", "posts/2020/Time.ipynb", "posts/2020/python-tutorial-faq.md", "posts/2020/python-tutorial-faq-part-2.md", "posts/2020/python-tutorial-faq-part-3.md", "posts/2020/templating-isnt-just-for-web-developers.md", "posts/2020/tutorial-seminar-series.md", "posts/2020/writing-multiple-netcdf-files-in-parallel-with-xarray-and-dask.ipynb", "posts/2021/Interactive_Dashboard.md", "posts/2021/advanced-plotting-tutorial.md", "posts/2021/benchmarking-history-timeseries-intake.ipynb", "posts/2021/cartopy-tutorial.md", "posts/2021/casper_pbs_dask.md", "posts/2021/cesm-datashader.ipynb", "posts/2021/cesm-workshop-2021-diagnostics.md", "posts/2021/dask-summit-takeaway.md", "posts/2021/dask-tutorial.md", "posts/2021/dask-tutorial-update.md", "posts/2021/ecgtools-history-files-example.ipynb", "posts/2021/esds-blog.md", "posts/2021/esds-update-november-2021.md", "posts/2021/esds-update-october-2021.md", "posts/2021/esds-update-september-2021.md", "posts/2021/geocat-comp-tutorial.md", "posts/2021/geocat-tutorial.md", "posts/2021/git-and-github-tutorial.md", "posts/2021/graphviz_example.ipynb", "posts/2021/intake-cesm2-le-glade-example.ipynb", "posts/2021/intake-esm-derived-variables.ipynb", "posts/2021/intake-esm-holoviews-diagnostics.ipynb", "posts/2021/intake-esm-tutorial-2021.md", "posts/2021/intake-obs-cesm2le-comparison.ipynb", "posts/2021/intake_cmip6_debug.md", "posts/2021/intake_esm_dask.md", "posts/2021/jupyter-based-diagnostics-overview.ipynb", "posts/2021/jupyter-notebooks-faq.md", "posts/2021/kay-et-al-cesm2-le.ipynb", "posts/2021/map_blocks_example.md", "posts/2021/matplotlib-faq.md", "posts/2021/matplotlib-tutorial.md", "posts/2021/model_documentation_jupyterbook.ipynb", "posts/2021/multiple_index_xarray_xoak.md", "posts/2021/ncar-jobqueue-example.md", "posts/2021/numpy-faq.md", "posts/2021/numpy-tutorial.md", "posts/2021/object-oriented-programming-tutorial.md", "posts/2021/oop-tutorial.md", "posts/2021/paired_programming_vs.md", "posts/2021/pandas-tutorial.md", "posts/2021/project-pythia-overview.md", "posts/2021/python-tutorial-seminar-series-spring-2021.md", "posts/2021/regrid-observations-pop-grid.ipynb", "posts/2021/scaling-with-dask-class-takeaways.md", "posts/2021/scipy-2021-takeaways.md", "posts/2021/software-citation.md", "posts/2021/weather-station-data-preprocess.ipynb", "posts/2021/xarray-tutorial.md", "posts/2021/xarray-wrf-example.ipynb", "posts/2021/yearly-averages-xarray.ipynb", "posts/2021/your-first-package-python-tutorial-faq.md", "posts/2022/Thinking-with-Xarray.md", "posts/2022/batch-processing-notebooks-with-papermill.md", "posts/2022/cam-se-regridding.ipynb", "posts/2022/dask-debug-detrend.ipynb", "posts/2022/debugging.md", "posts/2022/esds-event-prep.md", "posts/2022/esds-event-recap.md", "posts/2022/esds-fall-event.md", "posts/2022/metpy_tutorial.md", "posts/2022/office-hours-appointments.md", "posts/2022/sparse-PFT-gridding.ipynb", "posts/2022/xarray-groupby-vs-geocat-climatology.ipynb", "posts/2022/yourfirst.md", "posts/2023/cam-se-analysis.ipynb", "posts/2023/cesm2-le-timeseries-kerchunk.ipynb", "posts/2023/esds-annual-event.md", "posts/2023/kerchunk-mom6.ipynb", "posts/2023/mfdataset.ipynb", "posts/2023/office-hours-help.md", "posts/2023/scipy23.md", "posts/2023/unstructured-grid-collab-1.md", "posts/2024/containerize-visualizations-event.md", "posts/2024/esds-annual-event-recap.md", "projects.md"], "indexentries": {}, "objects": {}, "objnames": {}, "objtypes": {}, "terms": {"": [0, 2, 6, 7, 8, 10, 12, 14, 15, 17, 19, 20, 21, 23, 25, 26, 27, 33, 34, 36, 37, 39, 40, 41, 42, 43, 44, 46, 47, 49, 50, 51, 52, 53, 55, 56, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 71, 72, 74, 75, 77, 78, 80, 83, 84, 85, 86, 87, 88, 89], "0": [7, 8, 11, 13, 14, 17, 18, 20, 23, 28, 30, 36, 38, 39, 41, 43, 46, 47, 50, 51, 63, 65, 67, 68, 71, 72, 73, 80, 81, 83, 84, 86, 87], "00": [7, 11, 17, 20, 22, 23, 28, 36, 37, 38, 39, 41, 43, 46, 51, 52, 61, 65, 67, 68, 71, 72, 73, 77, 80, 81, 83, 84, 86, 87], "000": [46, 63], "0000": [46, 81], "00000": [23, 28, 38, 72, 84, 87], "000000000": [11, 46, 65, 67, 81], "0000000200408773e": 86, "000000e": [39, 41, 61, 68, 72, 80, 83], "0000089": 39, "00000valid_max": 41, "00001259": 39, "00001293": 39, "00001324": 39, "0000e": 86, "0001": [18, 20, 28, 86], "000101": 28, "000152": 41, "0001523": 41, "0002": [18, 28], "00025932e": 73, "0003": [18, 28], "0004": 28, "0004569": 41, "000457": 41, "000761": 41, "0007613": 41, "000832": 81, "000arrai": 41, "000e": [61, 72, 86], "000valid_max": 41, "001": [61, 84, 87], "001012": 28, "001065": 41, "001369": 41, "001673": 41, "001976": 41, "001_hfreq": 61, "001host": 84, "001intake_esm_dataset_kei": 61, "001lognam": [84, 87], "001xarrai": 61, "002": [39, 44, 72, 87], "0021": [23, 51], "002101": 23, "0021148": 81, "002278": 41, "0024": 61, "002497": 81, "00255": [8, 46], "00258": 41, "002881": 41, "002content": 39, "002titl": 72, "002xarrai": 39, "003": [18, 23, 51, 72, 83, 87], "003181": 41, "00344152e": 73, "00348": 41, "00365299": 81, "003778": 41, "003titl": 83, "004": [18, 39, 44, 86, 87], "004074": 41, "004168": 81, "00437": 41, "0046": 86, "004664": 41, "0049": 61, "004957": 41, "004_copy2": 44, "004e": 72, "005": [20, 87], "005236": 46, "005248": 41, "005538": 41, "00574897e": 73, "005826": 41, "006": [41, 87], "006112": 41, "006397": 41, "006679": 41, "006959": 41, "007": 87, "0070": 86, "0071": 86, "007238": 41, "007498": 81, "007514": 41, "0077": 41, "007788": 41, "00782921": 81, "008": 87, "008059": 41, "0081": 39, "00832280420835": 86, "008328": 41, "008594": 41, "008858": 41, "009": 87, "009119": 41, "00916852": 81, "009378": 41, "009633": 41, "009886": 41, "00_build_catalog": 44, "00arrai": 65, "00avg_period": [46, 81], "00axi": 61, "00bound": 46, "00intake_esm_attr": 38, "00intake_esm_dataset_kei": 38, "00long_nam": [17, 23, 80, 83], "00prev_avg_period": 81, "00standard_nam": [46, 81], "00west": 67, "00xarrai": 68, "01": [7, 8, 11, 17, 18, 20, 23, 28, 30, 36, 38, 39, 41, 46, 51, 61, 65, 68, 72, 73, 80, 81, 83, 84, 86, 87], "010": 87, "0100": 39, "010135": 41, "010381": 41, "010471": [38, 41, 46, 80, 84, 87], "010625": 41, "010865": 41, "011": [7, 87], "011102": 41, "011335": 41, "011565": 41, "011791": 41, "011e": 65, "011lognam": 87, "012": 87, "012014": 41, "012233": 41, "012448": 41, "01245054602623": [72, 83], "012451": [38, 46, 72, 83], "01266": 41, "012868": 41, "013": 87, "013072": 41, "013271": 41, "013467": 41, "01365061591797": 86, "013651": 86, "013659": 41, "013846": 41, "013e": 65, "014": 87, "01403": 41, "014209": 41, "014384": 41, "014554": 41, "01472": 41, "014881": 41, "015": [37, 87], "015038": 41, "01519": 41, "015338": 41, "015481": 41, "015619": 41, "015705": [38, 80], "015707": [41, 46, 84, 87], "015753": 41, "015882": 41, "016": [67, 87], "016006": 41, "016125": 41, "016239": 41, "016348": 41, "016452": 41, "016551": 41, "016645": 41, "016734": 41, "016818": 41, "016897": 41, "016971": 41, "017": 87, "017039": 41, "017103": 41, "017161": 41, "017214": 41, "017261": 41, "017304": 41, "017341": 41, "017373": 41, "017399": 41, "017421": 41, "017436": 41, "017447": 41, "017452": 41, "018": 87, "01881800963099": 86, "019": 87, "01_0001": 18, "01_0002": 18, "01_0003": 18, "01_0004": 18, "01_compute_20yr_mean": 44, "01arrai": 81, "01long_nam": [46, 81], "01t00": [46, 65, 67, 81], "01t03": 67, "01t06": 67, "01t09": 67, "01t12": [46, 67], "01t15": 67, "01t18": [11, 67], "01t21": 67, "01t23": 65, "01time_coverage_end": 61, "02": [7, 8, 17, 20, 22, 23, 32, 39, 41, 43, 46, 47, 51, 52, 61, 67, 68, 72, 78, 80, 81, 83, 84, 86, 87], "020": 87, "0202489197254": [72, 83, 84], "020249": [38, 41, 46, 72, 83, 84], "020942": 46, "023902202736755744read": 80, "024989565144135036read": 80, "02503": 72, "02607227e": 73, "026178": 46, "026667": 81, "02718": 41, "02750949e": 73, "02758525e": 73, "02760897": 39, "02962": 41, "02d": 61, "02t00": 67, "02t03": 67, "02t06": 67, "02t09": 67, "02t12": [46, 67], "02t15": 67, "02t18": [11, 67], "02t21": 67, "03": [8, 17, 20, 28, 39, 41, 46, 47, 61, 65, 67, 68, 71, 72, 73, 81, 83, 84, 86, 87], "030000e": 80, "031414": [38, 41, 46, 80, 84, 87], "031691864132881": [72, 83, 84], "031692": [46, 72, 83, 84], "032": [46, 72, 83, 84], "03210576e": 73, "035002": 81, "03503042e": 73, "03647573e": 73, "036649": [41, 46, 84, 87], "03665": 80, "036652": [38, 80], "0368": 20, "03883591": 81, "03arrai": [61, 65, 72, 83], "03cartesian_axi": 86, "03formula_term": [46, 84], "03long_nam": [72, 83, 84], "03standard_nam": 61, "03t00": 67, "03t03": 67, "03t06": 67, "03t09": 67, "03t12": [46, 67], "03t15": 67, "03t18": [11, 67], "03t21": 67, "04": [8, 17, 20, 32, 39, 46, 61, 65, 67, 68, 72, 80, 81, 84, 86, 87], "041885": 46, "04267883": 83, "043": 41, "04348": 41, "04451493": 81, "04697": 41, "04712": 46, "0489": 41, "049": 41, "04971": 41, "04arrai": [65, 72], "04long_nam": 72, "04t00": 67, "04t03": 67, "04t06": 67, "04t09": 67, "04t12": 67, "04t15": 67, "04t18": 67, "04t21": 67, "04xarrai": 65, "05": [8, 17, 20, 28, 39, 41, 61, 65, 67, 68, 71, 73, 77, 80, 81, 84, 86, 87], "050000e": [39, 61, 68], "050112": 23, "05013439e": 73, "0502": 51, "05055": 41, "05097856e": 73, "050e": [72, 86], "051192e": [39, 61, 68], "05142": 41, "05226": 41, "052356": [41, 46, 84, 87], "052357": [38, 80], "05318": 41, "05756495e": 73, "05759162303664": [84, 87], "057592": [41, 46, 84, 87], "057594": [38, 80], "05789642": 37, "05arrai": 61, "05cell": 71, "05long_nam": [39, 61, 68], "05standard_nam": 61, "05t00": 67, "05t03": 67, "05t06": 67, "05t09": 67, "05t12": 67, "05t15": 67, "05t18": 67, "05t21": 67, "06": [8, 17, 20, 32, 38, 39, 41, 46, 61, 67, 71, 72, 73, 80, 81, 83, 84, 86, 87], "060000e": 80, "06090852": 83, "061279296875": [72, 83], "0620308e": 46, "0625": [72, 83], "0625e": 86, "0625valid_min": 61, "062827": 46, "064165": 81, "06641072": 83, "068063": [38, 41, 46, 80, 84, 87], "06arrai": 61, "06read": 83, "06t00": 67, "06t03": 67, "06t06": 67, "06t09": 67, "06t12": 67, "06t15": 67, "06t18": 67, "06t21": 67, "07": [8, 17, 28, 39, 46, 61, 67, 73, 81, 84, 86, 87], "07189739": 83, "073298": [41, 46, 84, 87], "073299": [38, 80], "0733": 80, "075633e": [39, 61, 68], "07664777": 81, "07671": 68, "07671233": 68, "07699458733379": 86, "076995": 86, "07736837": 83, "077a": 41, "07852571": 83, "078534": 46, "07966716": 83, "07arrai": [46, 67], "07cell_method": 46, "07t00": 67, "07xarrai": 67, "08": [8, 17, 20, 23, 28, 39, 41, 46, 61, 67, 72, 73, 75, 77, 81, 83, 84, 86, 87], "080000e": 80, "08163473": 39, "08209887026972625read": 80, "08219": 68, "08219178": 68, "08377": 46, "08493": 68, "08493151": 68, "08493arrai": 68, "086": 67, "08781827223608": 86, "087846e": [39, 61, 68], "089005": [38, 41, 46, 80, 84, 87], "08950491": 81, "09": [8, 17, 20, 28, 39, 61, 65, 67, 75, 77, 78, 80, 81, 83, 84, 86, 87], "0925": 81, "093948": 41, "094238": [38, 80], "09424": 80, "094241": [41, 46, 84, 87], "094976": 41, "09541132": 81, "09546": 65, "097114e": [39, 61, 68], "097156": 39, "098333": 81, "099476": 46, "09arrai": 65, "0arrai": [39, 41, 61, 65, 68, 72, 73, 80, 83], "0axi": 38, "0bcacd1c": 38, "0bound": 84, "0cartesian_axi": 86, "0case": 84, "0comment": [46, 61], "0coordin": 83, "0corner_lat": 67, "0dataset_titl": 46, "0dy": 67, "0dyn_opt": 67, "0fill_valu": 41, "0flag_soil_lay": 67, "0geospatial_lat_max": 61, "0geospatial_lat_unit": 61, "0geospatial_lon_max": 61, "0geospatial_lon_min": 61, "0geospatial_vertical_max": 61, "0geospatial_vertical_min": 61, "0histori": 80, "0intake_esm_attr": 38, "0inverse_flatten": 61, "0licens": 61, "0long_nam": [39, 41, 46, 72, 80, 84], "0m": 28, "0mbuilder": 28, "0mdepth": 28, "0mdirectorypath": 28, "0mexclude_pattern": 28, "0mextens": 28, "0mint": 28, "0mlist": 28, "0mnjob": 28, "0moad_cen_lat": 67, "0mpydant": 28, "0mroot_path": 28, "0mstr": 28, "0mtype": 28, "0nco": 38, "0pole_lat": 67, "0pole_lon": 67, "0r": [72, 83], "0rxarrai": [72, 83], "0semi_major_axi": 61, "0sourc": [23, 72, 83, 84, 87], "0standard_nam": 87, "0th": 13, "0truelat1": 67, "0truelat2": 67, "0valid_max": [39, 61], "0valid_min": 68, "0x2ae53e497a90": 80, "0x2ae53eaa7220": 80, "0x2ae53eaa77c0": 80, "0x2ae53f25af40": 80, "0x2ae53fb0d7f0": 80, "0x2ae53fc79bb0": 80, "0x2ae53fd9dca0": 80, "0x2ae53fedf640": 80, "0x2ae55c00f850": 80, "0x2b1c86b5f2e0": 61, "0x2b1c89523a00": 61, "0x2b84d46c84c0": 38, "0x2ba103a57eb0": 39, "0x7fd46e54acd0": 73, "0xarrai": 83, "1": [0, 6, 7, 8, 11, 12, 13, 14, 16, 17, 18, 19, 20, 21, 22, 23, 26, 27, 28, 30, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 46, 47, 49, 50, 51, 52, 54, 55, 56, 58, 60, 61, 62, 63, 65, 66, 67, 68, 70, 72, 73, 75, 76, 77, 78, 80, 81, 82, 84, 86, 87, 90], "10": [7, 8, 12, 13, 16, 17, 18, 20, 28, 30, 31, 37, 38, 39, 41, 43, 46, 47, 60, 61, 63, 65, 67, 68, 72, 73, 76, 77, 80, 81, 83, 84, 86, 87], "100": [7, 8, 28, 29, 37, 38, 39, 41, 43, 46, 61, 63, 67, 68, 71, 72, 73, 80, 86], "1000": [37, 38, 41, 46, 61, 67, 72, 83, 84], "10000": 61, "100000": [61, 67], "1000e": 86, "1001": [41, 84], "1004": 72, "10090386867523": [72, 83, 84], "100904": [38, 41, 46, 72, 83, 84], "100e": 72, "100m": [43, 87], "100mb": 87, "101": [38, 41], "1011": [65, 87], "1013": 65, "1015707326662": 86, "101763": 67, "101890": 67, "101914": 67, "101925": 67, "101949": 67, "101986": 67, "102": [38, 46, 80], "102007": 67, "102015": 67, "102018": 67, "102028": 67, "102046": 67, "102048": 67, "102049": 67, "102067": 67, "102096": 67, "102118": 67, "102203": 67, "102205": 67, "102211": 67, "102215": 67, "102241": 67, "102274": 67, "102282": 67, "102318": 67, "102340": 67, "102343": 67, "102351": 67, "102359": 67, "102362": 67, "102373": 67, "102379": 67, "102404": 67, "102449": 67, "102484": 67, "102487": 67, "102488": 67, "102492": 67, "102496": 67, "1025": 61, "102534": 67, "102537": 67, "102549": 67, "102578": 67, "102613": 67, "102618": 67, "102629": 67, "102644": 67, "102648": 67, "102663": 67, "102679": 67, "102686": 67, "102695": 67, "102698": 67, "102737": 67, "102752": 67, "102769": 67, "102777": 67, "102788": 67, "102820": 67, "10282701e": 73, "1028296": 86, "102835": 67, "102858": 67, "102877": 67, "102894": 67, "102934": 67, "102951": 67, "102952": 67, "102977": 67, "102982": 67, "102992": 67, "102k": 71, "103": [38, 41, 46, 72, 83, 84], "103004": 67, "103012": 67, "103014": 67, "103026": 67, "103027": 67, "103036": 67, "103038": 67, "103042": 67, "103049": 67, "103085": 67, "1031": 87, "10311168e": 73, "103122": 67, "1032": [7, 37], "10320": 72, "104": 38, "104414": 80, "104614": 41, "104712": 46, "104memoryord": 67, "105": [37, 38, 41, 65], "1050": 61, "105000": 61, "1051": 87, "105arrai": 38, "105k": 71, "106": 41, "106204e": [39, 61, 68], "107": [46, 67], "1071": 87, "1072": 20, "1075": 61, "10763635e": 73, "108": [41, 87], "10800": 72, "1089941": 81, "1091": 87, "10921096": 86, "10970": 46, "109947": [38, 80], "109948": [41, 46, 84, 87], "10am": 77, "10b0k7vx": 37, "10cft_barlei": 80, "10gb": [17, 22, 52], "10levdcmp": 80, "10th": [8, 13, 54, 56, 75, 77], "10z": 80, "11": [7, 8, 13, 15, 16, 17, 20, 23, 28, 36, 37, 38, 39, 41, 46, 61, 65, 68, 72, 76, 77, 80, 81, 83, 84, 86, 87], "110": [41, 81], "1100": 61, "110000": 61, "11025": 81, "111": [37, 46, 72, 83, 84], "11103": 39, "1111": 87, "111429": 80, "111429pft": 80, "11167": 81, "112": [41, 46, 61, 72, 83], "11219": [46, 72, 83, 84], "112190246582": [72, 83, 84], "1125": 61, "11280": 72, "1128696": 61, "113": [38, 67], "1131": 87, "114": [41, 72, 83], "1140": 38, "1140lev": 38, "11449891328812": 84, "114499": 84, "115": 83, "1150": 61, "115000": 61, "1151": 87, "11518": 80, "115181": [38, 80], "115183": [41, 46, 84, 87], "1151832460733": [84, 87], "1152": [72, 83], "1152coordin": 83, "1152cosp_scol": 72, "1152lat": 83, "1152ncol": 83, "1152time": 72, "116": [41, 83], "117": 46, "1171": 87, "117216": [46, 72, 83, 84], "11721634864807": [72, 83, 84], "1175": [8, 46, 61], "11760": 72, "118": 41, "11881845": 81, "119": 41, "1191": 87, "11910376": 86, "11am": 77, "11cft_irrigated_barlei": 80, "11eb": 37, "11ec": [38, 41, 46, 61, 67, 68, 73], "11ed": [84, 86], "11ee": [83, 87], "11th": [8, 26, 27, 75, 77], "12": [7, 8, 11, 17, 18, 20, 23, 28, 36, 37, 38, 39, 41, 46, 51, 60, 61, 65, 67, 68, 72, 73, 77, 80, 81, 83, 84, 86, 87], "120": [23, 41, 51, 67, 72, 80, 83], "1200": [61, 72], "12000": 67, "120000": 61, "120419": 46, "120convent": [23, 72, 83], "121": [38, 41, 46, 72, 83, 84], "121664": 81, "122": 46, "12240": 72, "1225": 61, "12255859375": [72, 83], "1226": 67, "123": 41, "12309913e": 73, "1231": [37, 87], "1234": 15, "12345": 15, "1240": 61, "1243": 41, "124517cf72a30883d5a3c70220985aeeivt": 72, "125": [41, 46, 61, 67, 72, 80, 83], "1250": 61, "12500": 61, "125000": 61, "125000e": [72, 83], "12500894": 39, "125028e": [39, 61, 68], "1250e": 86, "1251": [37, 87], "125654": [38, 41, 46, 80, 84, 87], "125768e": [39, 61, 68], "125e": [28, 39, 68, 86], "126": 41, "127": [17, 41, 46, 73, 86], "12720": 72, "1275": 61, "12784": 11, "128": 84, "1280": 61, "1281": [37, 87], "12899656": 86, "129": 41, "12arrai": 61, "12cft_winter_barlei": 80, "12th": [8, 35], "12z": 67, "12z_t": 61, "13": [7, 8, 17, 20, 23, 32, 37, 38, 41, 46, 51, 61, 65, 67, 72, 73, 77, 80, 81, 83, 84, 86, 87], "130": 28, "1300": 61, "130000": 61, "1301": [37, 87], "13089": [38, 41, 46, 80, 84, 87], "131": [41, 46, 72, 83, 84], "132": [46, 67], "13200": 72, "13249928": 81, "1325": 61, "132z": 67, "133": 41, "133405e": [39, 61, 68], "13371148": 81, "135": [41, 81], "1350": 61, "135000": 61, "13527": 41, "136": [41, 87], "136126": 46, "13680": 72, "137": [46, 61], "1375": 61, "1378": 20, "138": 41, "13888936": 86, "139351": 41, "13997774668711": 86, "139978": 86, "13cft_irrigated_winter_barlei": 80, "13isoilwat": 67, "13lat": 41, "14": [8, 16, 17, 23, 31, 37, 38, 41, 46, 60, 65, 67, 71, 72, 77, 80, 81, 83, 84, 86, 87], "140": 41, "1400": 61, "140000": 61, "14059230e": 73, "1411": 65, "141361": 46, "14160": 72, "142": [38, 41, 46, 72, 83, 84, 86], "14225": 41, "1425": 61, "14384": 41, "144": 41, "1440": 61, "1440depth": 61, "1440nbound": 61, "1447": 28, "145": 67, "1450": 61, "145000": 61, "146": [41, 83], "1460": 84, "14600": 72, "14600coordin": 72, "14600lat": 72, "14600lev": 72, "14600ncol": 72, "14640": 72, "146597": [38, 41, 46, 80, 84, 87], "147": [41, 46], "1475": 61, "1476": 68, "148": [41, 72, 83], "1480550400": 65, "148336": 81, "14878216": 86, "149": 41, "1499288082123": 84, "14992880821234": [72, 83], "149929": [46, 72, 83, 84], "14cft_rye": 80, "14grid_id": 67, "14th": [8, 16, 26, 55], "15": [7, 8, 17, 20, 28, 32, 37, 38, 41, 46, 61, 65, 68, 71, 72, 77, 80, 81, 83, 84, 86, 87], "150": [41, 61], "1500": 61, "15000": 61, "150000": 61, "150000e": [39, 61, 68], "150e": [72, 86], "151": [41, 87], "15120": 72, "15183": 80, "151832": [41, 46, 84, 87], "151833": [38, 80], "152": [28, 46], "15208992": 39, "15217317": 81, "15285272": 81, "153": [41, 46], "15362": 38, "154": [46, 72, 83, 84], "1543505128": 46, "1543508400": 46, "155": [41, 81], "15524177e": 73, "1553762": 23, "15548862": 81, "15600": 72, "15642686824839": 86, "157": [41, 46], "157068": 46, "15752314e": 73, "157947": [46, 72, 83, 84], "15794742852449": [72, 83, 84], "15831": 41, "158333": 81, "15844975e": 73, "15867496": 86, "159": 41, "15cft_irrigated_ry": 80, "15cosp_sza": 72, "15isurban": 67, "15time": 72, "16": [7, 8, 17, 36, 37, 38, 40, 41, 46, 47, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "160": [20, 38, 68, 80, 84], "16080": 72, "161": 41, "162": [46, 61], "162304": 46, "163": 41, "164": [67, 80], "16426": 84, "16426coordin": 84, "16426lev": 84, "165": 41, "16560": 72, "166": [41, 80], "166408": 80, "1664080": 80, "1664081": 80, "166408dask": 80, "166408time": 80, "167": [46, 61], "167498": 81, "167538": [38, 80], "167539": [41, 46, 84, 87], "168": [38, 41, 46, 68, 72, 83, 84], "1680": 72, "16856776": 86, "16895": 41, "169": 67, "16928": 41, "1697": 41, "16_1981": 17, "16_1982": 17, "16_1983": 17, "16cft_winter_ry": 80, "16z": 67, "17": [8, 17, 20, 28, 32, 37, 38, 41, 46, 61, 63, 65, 72, 73, 80, 81, 83, 84, 87, 90], "170": 41, "1700": 80, "170001": 80, "1701": 41, "17040": 72, "1706": 41, "171": 61, "1711": 41, "172": [41, 46, 61], "1720": 20, "17207442": 39, "1721": 37, "17241696": 39, "17277486910994": [84, 87], "172775": [38, 41, 46, 80, 84, 87], "17365": 41, "174": 41, "175": 61, "17500": 61, "17520": [72, 83], "17522": 87, "176": [41, 67], "1764": 61, "1764z_t": 61, "17660861e": 73, "177": [46, 61], "178": [23, 41], "17801": 46, "17846056": 86, "179": [20, 41, 61], "17_00": 67, "17cft_irrigated_winter_ry": 80, "17islak": 67, "17min": 84, "18": [8, 17, 20, 31, 37, 38, 41, 46, 47, 67, 72, 80, 81, 83, 84, 87, 92], "180": [23, 28, 37, 41, 61, 63, 81], "18000": 72, "180mb": 87, "180time": 41, "181": [37, 41, 46, 72, 81, 83, 84], "181440": 67, "181818": 67, "181920": 67, "182": [81, 84, 87], "18202": 86, "182299": 67, "1825": 87, "18262": 46, "183": [41, 81], "183246": [38, 41, 46, 80, 84, 87], "184": [37, 81], "18480": 72, "185": [37, 41, 81], "1850": [8, 37, 46, 84, 85, 87, 91], "18500101": [84, 87], "1851": 46, "1852": 46, "1853": 46, "1854": 46, "18591231": [84, 87], "18597561": 39, "18597562": 39, "186": [41, 80, 81], "1860": 41, "18600101": [84, 87], "186457e": [39, 61, 68], "1868": 37, "18691231": [84, 87], "187": [41, 61, 81], "18700101": [84, 87], "1875": [72, 83], "18750883": 39, "1875read": 80, "18776": 46, "18791231": [84, 87], "188": [41, 81], "18800101": [84, 87], "18835336": 86, "18848": [38, 80], "188482": [41, 46, 84, 87], "18891231": [84, 87], "189": [41, 81], "18900101": [84, 87], "189278": 41, "18933231": 39, "18960": 72, "18985": 41, "18991231": [84, 87], "18996016223117": 86, "18cft_cassava": 80, "18th": [8, 85], "19": [8, 20, 32, 37, 38, 39, 41, 46, 67, 68, 72, 73, 80, 81, 83, 84, 87], "190": [41, 81], "1900": [11, 62], "19000101": [84, 87], "190243": 41, "19091231": [84, 87], "191": [28, 41, 46, 81], "19100101": [84, 87], "19115standard_name_vocabulari": 61, "19191231": [84, 87], "191slon": 46, "192": [20, 37, 38, 41, 46, 72, 80, 81, 84, 87], "1920": [7, 36, 46, 72], "192001": [7, 72], "19200101": [84, 87], "1928184": 61, "19288036": 81, "1929": 72, "192912": 72, "19291231": [84, 87], "19296261e": 73, "192coordin": 87, "192ensembl": 87, "192gridcel": 80, "192lon": [38, 41, 46, 80, 84, 87], "193": [41, 81], "19300101": [84, 87], "193717": 46, "19375": [41, 84], "1937500834465": 84, "19391231": [84, 87], "194": 81, "19400101": [84, 87], "194912": 42, "19491231": [84, 87], "195": [41, 67, 81], "1950": 11, "19500101": [84, 87], "1954": 67, "1955": 61, "1958": 61, "19591231": [84, 87], "195e": 72, "196": [41, 81], "19600101": [84, 87], "19603941": 39, "1961": 46, "196312": 67, "1969": 18, "19691231": [84, 87], "197": [38, 41, 46, 72, 81, 83, 84], "1970": [65, 84], "19700101": [84, 87], "1979": [11, 17, 41], "19791231": [84, 87], "198": [41, 81], "1980": [17, 41], "19800101": [84, 87], "1980lev": 41, "1981": [17, 61], "1982": [17, 81], "1983": [17, 81], "198398": [38, 41, 46, 72, 83, 84], "1983984708786": [72, 83, 84], "1984": 81, "1985": 81, "1986": 81, "19891231": [84, 87], "198953": 46, "199": 81, "1990": 46, "19900101": [84, 87], "1993": 63, "1994": 17, "199844e": 80, "199912": 42, "19991231": [84, 87], "19cft_irrigated_cassava": 80, "19long_nam": 39, "19th": [8, 85, 92], "1arrai": [46, 65], "1bound": 72, "1cd0605d461b": 68, "1cft_c3_irrig": 80, "1coordin": [41, 61, 84], "1ctype_crop": 80, "1d": [25, 80], "1d915812": 38, "1depth": 61, "1descript": 67, "1dst_grid_rank": [72, 83], "1e": [41, 46, 61, 72, 83, 84], "1e2": 47, "1e9": [84, 87], "1ea82bb067c3273a6166d1b1f77d490f": 73, "1flag_canfra": 67, "1flag_clayfrac": 67, "1flag_erod": 67, "1flag_excluded_middl": 67, "1flag_frc_urb2d": 67, "1flag_imperv": 67, "1flag_lai12m": 67, "1flag_lake_depth": 67, "1flag_mf_xi": 67, "1flag_psfc": 67, "1flag_sandfrac": 67, "1flag_slp": 67, "1flag_sm000007": 67, "1flag_sm007028": 67, "1flag_sm028100": 67, "1flag_sm100289": 67, "1flag_snow": 67, "1flag_snowh": 67, "1flag_soilhgt": 67, "1flag_sst": 67, "1flag_st000007": 67, "1flag_st007028": 67, "1flag_st028100": 67, "1flag_st100289": 67, "1flag_urb_param": 67, "1flag_var_sso": 67, "1gwrko6h": 37, "1i_parent_end": 67, "1i_parent_start": 67, "1j_parent_start": 67, "1lev": 41, "1long_nam": 46, "1ltype_crop": 80, "1mminlu": 67, "1nbnd": 84, "1nc79fcf": 73, "1nco": 17, "1ncol": [23, 72], "1num_metgrid_level": 67, "1num_metgrid_soil_level": 67, "1p4": 20, "1parent_id": 67, "1pfts1d_gi": 80, "1pfts1d_itype_col": 80, "1pfts1d_jxy": 80, "1revision_id": 38, "1season": 41, "1south": 67, "1sr_x": 67, "1sr_y": 67, "1st": [11, 13], "1time": 41, "1unit": [38, 41, 84], "1v3": 61, "1v3_conserv": 61, "1vvvvvvgav": 86, "1west": 67, "1xarrai": 67, "1z_t": 61, "2": [6, 7, 8, 11, 12, 14, 17, 18, 20, 22, 23, 26, 27, 28, 30, 34, 36, 37, 38, 39, 41, 42, 43, 46, 47, 51, 52, 61, 63, 65, 66, 67, 68, 72, 76, 77, 80, 81, 84, 86, 87, 88, 90], "20": [8, 15, 20, 32, 37, 38, 41, 46, 61, 63, 65, 67, 68, 72, 80, 81, 83, 84, 86, 87], "200": [37, 41, 43, 61, 63, 72, 81, 83], "2000": [41, 61, 83, 87], "20000": 61, "20000101": [84, 87], "2000010100z": 83, "2000123121z": 83, "2000e": 86, "2001": [63, 83], "2002": 41, "2005": [7, 11, 36, 61], "200512": 7, "2006": [7, 36, 38, 41], "2006xarrai": 41, "2009": [8, 84], "20091231": [84, 87], "200m": 86, "200mb": 7, "201": 81, "2010": 61, "20100101": [84, 87], "2011": [67, 72], "2012": [46, 80], "2013": [11, 41], "2014": [41, 46, 84], "20140724": 41, "20140724xarrai": 41, "20141231": [84, 87], "2014institut": 41, "2015": [8, 31, 37, 63, 68, 84], "20150101": 87, "2016": [17, 65, 68], "20161201": 65, "2017": [46, 61, 67, 68], "2017576": 86, "2018": [10, 20, 46, 61, 68, 72, 80], "201812": 80, "2019": [8, 10, 40, 46, 61, 63, 68, 80], "2019arrai": 68, "2019xarrai": 68, "202": [41, 81, 83], "2020": [8, 15, 41, 46], "2021": [7, 8, 22, 23, 28, 37, 46, 61, 73, 83, 86], "2022": [7, 8, 72, 73, 76, 77, 78, 86], "2023": [0, 8, 83, 84, 86, 87, 90], "2024": 8, "20241231": 87, "20250101": 87, "202602": 86, "2026020735154": 86, "203": 81, "20341231": 87, "20350101": 87, "204": [41, 81], "204188": [41, 46, 84, 87], "204189": [38, 80], "20419": 80, "20440": 11, "20441231": 87, "20450101": 87, "205": [17, 61, 81], "20541231": 87, "20550101": 87, "205coordin": 17, "206": [23, 37, 38, 41, 46, 61, 67, 68, 81, 83, 84, 87], "2060": 46, "206017": 67, "2060nbnd": 46, "20641231": 87, "20650101": 87, "206667": 81, "20694": 41, "207": 81, "20741231": 87, "20750101": 87, "208": [20, 23, 41, 81], "20841231": 87, "20850101": 87, "209": 81, "20941231": 87, "209424": [41, 46, 84, 87], "209427": [38, 80], "20943": 80, "20950101": 87, "2098": 20, "20c": [36, 38, 43], "20cft_citru": 80, "20gb": 87, "20south_north": 67, "20th": [8, 38, 91], "21": [8, 20, 23, 28, 38, 41, 46, 67, 72, 80, 83, 84, 86, 87], "210": [41, 72, 81], "2100": [8, 36, 37, 38, 46, 68, 72, 87], "21001231": 87, "21013": 80, "21013landunit": 80, "211": [41, 81], "212": [61, 81, 84], "21241603e": 73, "213": [41, 46, 72, 81, 83, 84], "213333": 81, "214": 81, "21424802e": 73, "21466": 46, "2146959360": 46, "2146959360long_nam": 46, "2147483647": 61, "215": [41, 77, 81], "21524404": 81, "216": [46, 80, 81, 84], "2160": 72, "21650899": 39, "216665": 81, "217": [41, 81], "2177280": 67, "21790701": 81, "218": [41, 81], "2184": 73, "2185": 73, "2186": 73, "2187": 73, "2188": 73, "2189": 73, "219": [41, 72, 81], "2190": 73, "2191": 73, "2192": 73, "2192arrai": 73, "2193": 73, "21930": 73, "2193dask": 73, "2193eta_rho": 73, "219895": 46, "21aaa4ef": 41, "21cft_irrigated_citru": 80, "21coordin": 67, "21isic": 67, "21iswat": 67, "21st": 82, "22": [8, 17, 38, 39, 41, 46, 61, 67, 72, 80, 81, 83, 84, 86, 87], "220": 81, "22052261": 39, "221": [41, 81], "22139278e": 73, "222": 81, "223": [41, 81, 83], "2232": 86, "224": 81, "22442060709": [72, 83, 84], "224421": [46, 72, 83, 84], "22464592306768": 86, "22487": 41, "225": [41, 61, 81], "22500": 61, "22507977485657": [72, 83, 84], "22508": [38, 41, 46, 72, 83, 84], "2250859320": 86, "225131": [41, 46, 84, 87], "225132": [38, 80], "225783e": [39, 61, 68], "225832": 81, "226": [41, 81], "22632": 41, "2267": 41, "227": 81, "22708": 41, "22745": 41, "22787": 41, "228": [41, 72, 81], "2284507": 81, "229": 81, "22cft_cocoa": 80, "23": [8, 23, 37, 38, 41, 46, 61, 63, 65, 67, 72, 73, 80, 81, 83, 84, 87], "230": [41, 81, 83], "230366": [41, 46, 84, 87], "2303664921466": [84, 87], "23037": [38, 80], "2304": 61, "23048": 86, "231": [81, 83], "23133097": 81, "232": [37, 38, 41, 46, 72, 81, 83, 84], "233": 81, "2332806": [72, 83], "234": [41, 81, 84], "23459477": 39, "234624": 41, "235": 81, "235054": 41, "235602": 46, "236": [41, 81], "237": [61, 81], "23753": 41, "238": [41, 81], "239": 81, "23950080": 67, "23cft_irrigated_cocoa": 80, "23gb": 87, "23rd": [8, 66, 82], "23x0": [72, 83], "24": [8, 17, 20, 38, 41, 46, 51, 60, 67, 68, 72, 73, 80, 81, 83, 84, 87], "240": [20, 39, 41, 46, 67, 72, 81, 83], "2400": 61, "2400nlon": 61, "2401": 61, "2401nlon_b": 61, "240499": 84, "2404990196228": 84, "24052915": 39, "240838": [38, 41, 46, 80, 84, 87], "241": [41, 81], "241902": [38, 41, 46, 72, 83, 84], "2419023513794": [72, 83, 84], "242": 81, "243": [41, 81, 83], "244": [51, 81, 83], "244567e": [39, 61, 68], "245": [41, 72, 81], "245482": 46, "246": 81, "246073": [41, 46, 84, 87], "246075": [38, 80], "24621668": 39, "24693": 67, "247": [41, 81], "247320": 86, "247498": 81, "248": [46, 65, 72, 81, 83], "24806791e": 73, "24845055": 81, "249": [23, 41, 81], "249998": 81, "24cft_coffe": 80, "24eta_rho": 73, "24th": [8, 49], "25": [7, 8, 16, 20, 37, 38, 41, 46, 51, 61, 65, 67, 68, 72, 80, 81, 83, 84, 86, 87], "250": [41, 61, 81, 87], "2500": 61, "25000": 61, "250000e": [39, 61, 68, 72, 83], "25000897": 39, "2500e": 86, "2501": 39, "250e": [72, 86], "251": [41, 46, 72, 81, 83, 84], "25103166": 81, "2512": 20, "251309": 46, "25133086": 39, "252": 81, "2522664000": 86, "253": [41, 65, 81], "254": [41, 81], "2541": 41, "255": [41, 46, 72, 81, 83, 84], "255239523947239": [72, 83, 84], "25524": [46, 72, 83, 84], "25577325": 39, "256": [8, 41, 43, 81, 84], "2560": 38, "2561": 38, "256545": 46, "25664": 67, "256gb": 43, "257": 81, "25723arrai": 61, "258": [41, 51, 81], "25875887e": 73, "259": [28, 81], "25_hist_78pfts_trendy_simyr1700_c190814": 80, "25_nc3000_nsw042_nrs008_co060_fi001_zr_sgh30_24km_grnl_c170103": [84, 87], "25_remap_c051027": 38, "25cft_irrigated_coffe": 80, "25deg": 83, "25e": 86, "25levlak": 80, "25lon": 80, "25th": [8, 34], "26": [8, 37, 38, 41, 46, 60, 67, 71, 72, 80, 81, 84, 86, 87], "260": [28, 41, 65, 81], "261": [28, 81], "26135": 65, "26178": [38, 41, 46, 80, 84, 87], "262": [28, 41, 61, 81], "263": [28, 81], "264": [28, 41, 81, 84], "2640": 72, "265": [41, 80, 81], "2654208": [72, 83], "2654208coordin": [72, 83], "265arrai": 80, "266": [41, 67, 81], "267": 81, "26701": 80, "267014": [38, 80], "267016": [41, 46, 84, 87], "267f8112b7b54af2dbd898356bfcb6f7": 73, "268": [41, 81], "26822889e": 73, "26829977333546": [72, 83], "2683": [38, 46, 72, 83], "268680e": [39, 61, 68], "269": 81, "2694": 61, "26cft_cotton": 80, "26th": [8, 58, 82], "27": [8, 16, 17, 32, 38, 41, 46, 61, 65, 67, 72, 80, 81, 84, 87], "270": [41, 81], "270000e": 80, "2705": 37, "271": [41, 81], "271692": 41, "272": [41, 81], "272251": 46, "2723049127": 20, "273": [37, 38, 41, 46, 72, 81, 83, 84], "273001": 84, "27300125360489": 84, "27313195537674": 86, "27368": 86, "274": [81, 84, 90], "275": [17, 41, 61, 65, 73, 81, 90], "27500": 61, "2753": 61, "275y": 17, "276": 81, "2765": 61, "276665": 81, "276667": 81, "276820": 46, "277": [41, 81], "277280e": [39, 61, 68], "277487": 46, "278": 81, "279": [41, 81, 83], "27997": 41, "27cft_irrigated_cotton": 80, "27th": [8, 19], "28": [8, 16, 28, 32, 37, 38, 39, 41, 46, 60, 61, 67, 68, 72, 80, 81, 83, 84, 86, 87], "280": [81, 86], "280005": 81, "281": [38, 41, 81, 86], "28146696": 81, "28179298": 81, "282": [81, 86], "28241782": 81, "282722": [38, 80], "282723": [41, 46, 84, 87], "283": [41, 51, 81, 86, 90], "284": [46, 81, 86], "284599": 41, "285": [41, 81, 86], "28551": 41, "286": [41, 81, 86], "287": [61, 81], "287956": [38, 80], "287958": [41, 46, 84, 87], "28795811518324": [84, 87], "28796": 80, "288": [38, 41, 46, 65, 80, 81, 84, 87], "2881": 65, "2882": 46, "288271": 41, "28854": 11, "28855": 11, "28856": 11, "288coordin": [46, 65], "288dask": [41, 46, 80, 87], "288ilev": [46, 84], "288lat": [80, 87], "288nbnd": 38, "288vegtyp": 80, "288zlon": 84, "289": [67, 81], "28901640e": 73, "28_03": 67, "28cft_datepalm": 80, "28t00": 46, "28t03": 67, "28t06": 67, "28t09": 67, "28t12": 67, "28t15": 67, "28t18": 67, "28t21": 67, "28th": [8, 21, 27], "29": [7, 8, 11, 30, 38, 41, 46, 61, 67, 68, 72, 80, 81, 83, 84, 86, 87], "290": [41, 51], "2903040": 67, "29031715": 39, "29031716": 39, "29065347072": 84, "291014": 46, "292": [41, 72], "2920": 83, "2920nbnd": 83, "2920ncol": 83, "29231": 41, "29247755224156": 86, "293": 46, "293194": 46, "294": 41, "29408252": 39, "29443": 46, "295": 81, "29595947265625": [72, 83], "296": [41, 46, 72, 83, 84], "2962": 20, "29642832": 39, "298": [41, 61, 83], "298429": [38, 41, 46, 80, 84, 87], "29989059": 81, "29cft_irrigated_datepalm": 80, "29t00": 67, "29t03": 67, "29t06": 67, "29t09": 67, "29t12": [46, 67], "29t15": 67, "29t18": [11, 67], "29t21": 67, "29th": 11, "2ab787b8": 37, "2afb02c0": 37, "2arrai": 41, "2cell_method": 46, "2cen_lat": 67, "2cft_temperate_corn": 80, "2coordin": [23, 38, 46, 61, 68, 73, 80, 83, 86], "2cosp_tau": 72, "2ctype_crop_noncompet": 80, "2d": [25, 63, 72, 73, 80, 83], "2d27": 46, "2descript": 67, "2df5": 67, "2e": [61, 72], "2gb": 62, "2i2c": [29, 63], "2lat": 83, "2lev": 84, "2lon": [61, 87], "2long_nam": 41, "2ltype_unus": 80, "2min": 46, "2mstorag": 80, "2n_a": [72, 83], "2nd": [8, 11, 16], "2r47banl": 41, "2slat": 46, "2valid_min": 41, "2var_desc": 81, "2z_i": 86, "2zlon": 84, "3": [7, 8, 11, 12, 13, 17, 18, 20, 28, 30, 32, 36, 38, 39, 41, 44, 46, 51, 61, 65, 67, 68, 72, 73, 77, 80, 81, 84, 86, 87], "30": [7, 8, 11, 20, 23, 32, 38, 41, 46, 61, 63, 65, 67, 68, 72, 73, 75, 77, 80, 81, 83, 84, 86, 87], "300": [41, 46, 61, 65, 67, 84, 86], "3000": 61, "30000": 61, "3000e": 86, "3006856": 86, "300z_l": 86, "301": 41, "30156": 41, "30160692": 39, "303": 41, "303665": [38, 41, 46, 80, 84, 87], "30467797e": 73, "30481": 41, "3049999": 46, "305": 41, "307": 41, "30846": 41, "308901": 46, "309": 41, "30bnd": 46, "30cft_foddergrass": 80, "30ilev": [72, 83], "30lat": 38, "30t00": [46, 67], "30t03": 67, "30t06": 67, "30t09": 67, "30t12": [46, 67], "30t15": 67, "30t18": [11, 67], "30t21": 67, "31": [7, 8, 11, 18, 36, 38, 41, 46, 67, 68, 72, 80, 81, 83, 84, 86, 87], "310": [65, 84], "31032": 86, "310974": 67, "311": 41, "3111": 68, "3111cell_method": [39, 61], "3111long_nam": [61, 68], "312": 61, "3120": 72, "3122": 41, "3125": [72, 83], "31250886": 39, "313": 41, "314136": 46, "315": 41, "3153792": 84, "316": [41, 65], "317": 39, "31712663173676": [72, 83, 84], "317127": [38, 41, 46, 72, 83, 84], "31757": 41, "318": [39, 41], "319": 39, "319372": [38, 41, 46, 80, 84, 87], "31_bilinear": [72, 83], "31arrai": 68, "31cft_irrigated_foddergrass": 80, "31cosp_pr": 72, "31lev": 46, "31long_nam": 46, "31mdocstr": 28, "31mfile": 28, "31minit": 28, "31msubclass": 28, "31mtype": 28, "31nbnd": 83, "31ncol": 83, "31t00": [46, 67], "31t03": 67, "31t06": 67, "31t09": 67, "31t12": [46, 67], "31t15": 67, "31t18": [11, 67], "31t21": 67, "31time": 83, "31time_coverage_dur": 61, "32": [7, 38, 41, 46, 61, 65, 67, 72, 80, 83, 84, 86, 87], "320": [28, 39, 41, 67, 68], "320coordin": 39, "320d2": 68, "320dask": 68, "321": 39, "322": [38, 39, 41, 46, 72, 83, 84], "32202": 41, "322e45e": 46, "323": 39, "323364": 67, "3234828710556": [72, 83], "323483": [46, 72, 83], "324": [39, 41, 87], "324607": [41, 46, 84, 87], "324608": [38, 80], "32461": 80, "324631": [46, 72, 83, 84], "3246314823627": [72, 83, 84], "325": [61, 80], "32500": 61, "325407": [38, 41, 46, 72, 83, 84], "325407391414": [72, 83, 84], "326": 41, "327558cf": 67, "32794": 37, "328": 41, "32852": 84, "32855": 37, "32910": 41, "32950": 86, "329843": 46, "32cft_grape": 80, "32ilev": 84, "32lat": [41, 84], "32mnone": 28, "32z": 61, "33": [7, 38, 41, 46, 65, 72, 80, 83, 84, 86, 87], "330": 41, "33049": 41, "330658": 41, "331": 41, "331665": 81, "33238192e": 73, "332777e": 80, "332806": 41, "332969": [46, 72, 83, 84], "3329690098763": [72, 83, 84], "333": 41, "333333": 86, "33333333333326": 86, "3333333333333333read": 80, "33333333333337": 86, "33354": 41, "335": 41, "335079": 46, "3352": 38, "33598": 41, "336": [20, 67], "3362": 65, "33624": 41, "33692": 68, "337": [41, 61], "33706454": 81, "33827": 41, "338688": 61, "338822": 46, "339": 41, "33cft_irrigated_grap": 80, "33nbnd": 84, "33time": 84, "34": [7, 28, 37, 38, 41, 46, 51, 71, 72, 80, 84, 86, 87], "340": 86, "340313": [38, 80], "340314": [41, 46, 84, 87], "340834": 81, "341": [23, 41], "342": 71, "342457": 46, "343": 41, "3437": 37, "344": [65, 86], "3441": 41, "34434": 41, "34462": 61, "3448": 20, "3449059562": 41, "345": 41, "3455497382199": [84, 87], "34555": [41, 46, 80, 84, 87], "345551": [38, 80], "346": [23, 41], "34664": 86, "34670": 41, "34684689": 81, "347": [84, 87], "348": [41, 46, 72, 83, 84, 87], "34834": 41, "349": 86, "34961": 67, "34cft_groundnut": 80, "34m": 28, "34nv": 86, "35": [20, 37, 38, 41, 46, 61, 65, 68, 72, 80, 81, 84, 86, 87], "350": [41, 51, 61, 84, 87], "3500": 61, "35000": 61, "350000e": [39, 61, 68], "3506875": 39, "35071255929034": 86, "350785": 46, "350e": 86, "351": [84, 87], "3510": 18, "35112": 41, "352": [41, 51, 84, 87], "35247403e": 73, "35266246": 81, "353": [84, 87], "35324": 37, "35342745": 39, "35352": 86, "3536666929722": [72, 83, 84], "353667": [46, 72, 83, 84], "3538944": [72, 83], "354": 41, "354164": 81, "35418436": 81, "355": [38, 41, 46, 80, 84, 87], "35514": 86, "356": [38, 41, 46, 72, 80, 83, 84, 87], "356021": [38, 41, 46, 80, 84, 87], "356632": [38, 41, 46, 72, 83, 84], "356632251292467": [72, 83, 84], "356668": 81, "357": [38, 41, 46, 72, 80, 83, 84, 87], "35723876953125": [72, 83], "35739": 41, "35795": 41, "358": [38, 41, 46, 72, 80, 83, 84, 87], "359": [41, 72, 81, 83], "35918431": 81, "35934": 37, "35941": 41, "35992386148148": 86, "35cft_irrigated_groundnut": 80, "35coordin": 86, "35e": 61, "35time": 46, "36": [7, 17, 28, 37, 38, 41, 46, 72, 80, 83, 84, 86, 87, 88], "360": [23, 41], "3600": [61, 72], "360000e": 80, "3600coordin": 61, "3600month": 61, "3600nlat_b": 61, "3601": 61, "3601coordin": 61, "3606": 80, "360lat": 41, "361256": [38, 80], "361257": [41, 46, 84, 87], "362": 61, "36298": 41, "363": 11, "3630706071854": [72, 83, 84], "363071": [46, 72, 83, 84], "36320": 41, "364": 11, "364088e": [39, 61, 68], "365": [8, 11, 28, 38, 39, 61, 68, 87], "3650": 84, "36501": 41, "36575": 86, "366": 11, "3664": 86, "366492": 46, "366588": [46, 72, 83, 84], "3665883541107": [72, 83, 84], "36674": 37, "36750": 37, "36759": 37, "36798033e": 73, "36870": 37, "36arrai": 46, "36cft_millet": 80, "36lon": 46, "36m0": 28, "36m1": 28, "36unit": 41, "36x": 17, "37": [7, 37, 38, 41, 46, 61, 65, 67, 68, 72, 80, 84, 87], "370": 20, "37012": 41, "371728": 46, "372": 61, "37239": 65, "37300": 41, "374": 41, "37428615e": 73, "3747cfcf": 68, "375": [41, 61, 67, 72, 83], "37500": 61, "375000e": [39, 61, 68], "375009": 39, "375392e": [39, 61, 68], "37543": 67, "37597": 84, "375e": [28, 39, 61, 68, 86], "37601": 37, "37603": 68, "37640": 41, "376963": [38, 41, 46, 80, 84, 87], "377": 80, "3778": 41, "3779": 41, "378": 67, "3780": 41, "3781": 41, "3782": 41, "37823": 46, "37861": 37, "378south": 67, "378west_east": 67, "379": [38, 41, 46, 67, 72, 83, 84], "379793e": [39, 61, 68], "379913": 41, "379bottom": 67, "379gridtyp": 67, "379parent_grid_ratio": 67, "379west_east_stag": 67, "37cft_irrigated_millet": 80, "38": [7, 17, 38, 39, 41, 46, 61, 67, 72, 80, 83, 84, 87], "380776": 41, "3810240": 67, "3810394638": 80, "382199": [41, 46, 84, 87], "3822": 80, "382202": [38, 80], "3828": 80, "3828coordin": 80, "3828hist_interv": 80, "3828pft": 80, "3828vegtyp": 80, "384": [28, 39, 68, 87], "38447": 41, "38461": 41, "384b9509": 46, "384nlon": [39, 68], "38517": 41, "38580": 38, "38592": 37, "38619": 41, "387": 61, "387435": 46, "38779": 67, "388626e": [39, 61, 68], "38943": [38, 41, 46, 72, 83, 84], "3894303143024": [72, 83, 84], "38cft_oilpalm": 80, "38south_north": 67, "38west": 67, "39": [7, 38, 41, 46, 65, 67, 72, 80, 84, 86, 87], "390": 83, "39016": 86, "39032": 46, "391": 41, "391205": 41, "39194": 41, "392": 83, "3923": 41, "39267": 46, "39383": 37, "39387129": 68, "39417": 41, "39483": 41, "395": 67, "39511": 41, "39517": 37, "39546": 86, "3957478e": 46, "39578": 41, "395e": 72, "39630478e": 73, "39636": 41, "3970": 20, "3971": 73, "39734": 41, "39748": 83, "39753": 41, "3978": 73, "397906": [41, 46, 84, 87], "397907": [38, 80], "39794947": 81, "397e": 61, "39800": 41, "39854": 37, "39893": 37, "398e": 61, "399168": 81, "3996136": 86, "399e": 61, "39cft_irrigated_oilpalm": 80, "3af9d394f1c6": 73, "3arrai": [65, 80], "3bnd": 87, "3c6e": 87, "3cecef19f78": 83, "3cecef1acbfa": 67, "3cecef1b11d": 61, "3cecef1b11e4": 68, "3cecef1b11f8": 87, "3cecef1b11fa": [38, 41, 84], "3cecef1b1236": 46, "3cecef1b12d4": 86, "3cft_irrigated_temperate_corn": 80, "3coordin": 87, "3ctype_landice_multiple_elevation_class": 80, "3d": [8, 32, 63, 73, 83, 86, 87, 92], "3d08bca5": 83, "3d_field": 47, "3descript": 67, "3fb4": 41, "3h": 83, "3hrly": 83, "3ltype_landice_multiple_elevation_class": 80, "3min": 84, "3mstorag": 80, "3nv_b": [72, 83], "3pm": 6, "3simulation_start_d": 67, "3time": 87, "3titl": 61, "3xarrai": 80, "3z": 67, "3z_t": 39, "4": [7, 8, 11, 13, 15, 17, 18, 20, 23, 25, 28, 30, 31, 36, 37, 38, 39, 41, 43, 46, 47, 51, 61, 65, 67, 68, 72, 73, 77, 80, 81, 84, 86, 87], "40": [7, 17, 20, 37, 38, 40, 41, 46, 61, 65, 72, 75, 77, 80, 81, 84, 87], "400": [20, 23, 39, 41, 61, 72, 83], "4000": [61, 63, 81], "40000": 61, "4000e": 86, "400497e": [39, 61, 68], "40121": 37, "40127062797546": 84, "4012706279755": [72, 83], "401271": [46, 72, 83, 84], "40194": 41, "402092": 67, "40213": 37, "40217": 38, "40259": 67, "403141": [41, 46, 84, 87], "40314136125654": [84, 87], "403145": [38, 80], "403287": 65, "40363": 41, "40381": 41, "404": 61, "40429": 41, "404481": [38, 41, 46, 72, 83, 84], "404481112957": [72, 83, 84], "40483624": 81, "40561": 41, "40586": 37, "40589": 41, "40662": 37, "407": 61, "40729": 37, "4080": 72, "408377": 46, "408m": 61, "409": [20, 46, 72, 83, 84], "40939": 37, "4094925": 67, "40979": 37, "40997": 67, "409a": 84, "40cft_potato": 80, "40cosp_sr": 72, "40lon": 81, "40time": 38, "41": [17, 38, 39, 41, 46, 51, 67, 72, 80, 83, 84, 87], "410": [20, 87], "411": 86, "41193498": 39, "412": 61, "41349": 41, "4135549": 39, "413613": [38, 41, 46, 80, 84, 87], "41381": 41, "41383": 37, "413972e": [39, 61, 68], "41397858": 39, "414762": 65, "415": 17, "41518": 41, "41635": 11, "41636": 11, "41637": 11, "41639": 41, "41646713": 81, "417498": 81, "417656": 80, "41805": 37, "41841155": 39, "41865507": 39, "418848": [41, 46, 84, 87], "41885": [38, 80], "4188851": 81, "419165": 81, "419168": 81, "41925": 41, "41cft_irrigated_potato": 80, "41long_nam": 39, "42": [38, 39, 41, 46, 51, 61, 72, 80, 84, 87], "420": 20, "42007": 41, "42090586": 81, "42132": 37, "421667": 81, "42231954773574": 86, "4225": 81, "42302146": 81, "42324": 37, "42370": 41, "424084": 46, "425": 61, "42500": 61, "426186": 41, "42649554": 39, "42672688e": 73, "42676562": 81, "42698694667925": 86, "427": 38, "42710": 37, "42757": 41, "427712938": 61, "428082": 41, "42880": 37, "429": 17, "42903": 80, "429319": 46, "42cft_puls": 80, "43": [38, 41, 46, 72, 80, 84, 87], "430": 36, "431": 36, "43115355": 81, "43117": 41, "431665": 81, "432": [36, 80], "4320": 86, "4323345348239": [72, 83, 84], "432335": [46, 72, 83, 84], "4326longitude_of_prime_meridian": 61, "433": 36, "43348": 41, "433777e": [39, 61, 68], "43385804": 81, "434": [28, 36, 39], "43415481": 81, "434555": [38, 41, 46, 80, 84, 87], "435": 36, "436666": 81, "437": 61, "4375": [72, 83], "43750889": 39, "4383": 67, "43851": 86, "439": 83, "43962": 84, "439789": [38, 80], "43979": 80, "439791": [41, 46, 84, 87], "43aadd5b": 61, "43cft_irrigated_puls": 80, "44": [38, 41, 46, 61, 72, 80, 81, 84, 87], "44002406e": 73, "4410": 46, "44174": 41, "442": 38, "44220": 41, "443": 61, "44356": 41, "44387": 41, "44458745": 81, "445": [38, 41, 46, 72, 81, 83, 84], "445026": 46, "44585338e": 73, "4458916187286": [72, 83, 84], "445892": [46, 72, 83, 84], "44592": 41, "446": 20, "44713": 41, "44954": 37, "44ba": 68, "44c2": 38, "44cft_rapese": 80, "44e3": 37, "45": [20, 38, 41, 46, 61, 65, 67, 72, 77, 80, 83, 84, 87], "450": 61, "4500": 61, "45000": 61, "450000e": [39, 61, 68], "450262": 46, "450e": [72, 86], "451": 17, "45101": 41, "45121": 86, "45124": 41, "45128": 41, "45160767": 39, "4523087": 67, "45250": 37, "4528": 20, "45282": 67, "45373": 41, "454165": 81, "455497": [41, 46, 84, 87], "455498": [38, 80], "45567": 41, "4560": 72, "45631811": 81, "4577638": 39, "45783": 87, "458": 86, "45826": 41, "458334": 81, "45848": 87, "45848824": 81, "458xh": 86, "458xq": 86, "459167": 81, "4596939": 67, "45cft_irrigated_rapese": 80, "45e": 61, "46": [38, 41, 46, 72, 80, 81, 83, 84, 86, 87], "460": 84, "4602": 67, "46073": 80, "460732": [38, 80], "46073298429319": [84, 87], "460733": [41, 46, 84, 87], "46147": 37, "46172": 41, "462": 61, "46231": 41, "465834": 81, "465969": 46, "46702": 41, "469": 86, "46cft_rice": 80, "46d6": 73, "47": [38, 41, 46, 61, 67, 72, 80, 83, 84, 87], "47083": 81, "471204": [38, 41, 46, 80, 84, 87], "47201141e": 73, "4720874": 81, "47289604": 73, "47291": 73, "4738819": 73, "475": 61, "47500": 61, "4751677": 37, "47517149e": 73, "47522": 41, "475e": 61, "476042": 41, "47644": [38, 41, 46, 80, 84, 87], "4770631": 81, "47743868e": 73, "477692e": 41, "47861806": 73, "47cft_irrigated_ric": 80, "48": [38, 41, 46, 72, 80, 81, 84, 87], "480": 67, "4803": 73, "48039159630041": 86, "4805504e": 65, "4805507e": 65, "4805510e": 65, "4805513e": 65, "4805516e": 65, "4805519e": 65, "4805522e": 65, "4805525e": 65, "4805528e": 65, "4805531e": 65, "4805534e": 65, "4805537e": 65, "4805540e": 65, "4805543e": 65, "4805546e": 65, "4805549e": 65, "4805552e": 65, "4805555e": 65, "4805558e": 65, "4805561e": 65, "4805564e": 65, "4805567e": 65, "4805570e": 65, "4805573e": 65, "4805576e": 65, "4805579e": 65, "4805582e": 65, "4805585e": 65, "4805588e": 65, "4805591e": 65, "4805594e": 65, "4805597e": 65, "4805600e": 65, "4805603e": 65, "4805606e": 65, "4805609e": 65, "4805612e": 65, "4805615e": 65, "4805618e": 65, "4805621e": 65, "4805624e": 65, "4805627e": 65, "4805630e": 65, "4805633e": 65, "4805636e": 65, "4805639e": 65, "4805642e": 65, "4805645e": 65, "4805648e": 65, "4805651e": 65, "4805654e": 65, "4805657e": 65, "4805660e": 65, "4805663e": 65, "4805666e": 65, "4805669e": 65, "4805672e": 65, "4805675e": 65, "4805678e": 65, "4805681e": 65, "4805684e": 65, "4805687e": 65, "4805690e": 65, "4805693e": 65, "4805696e": 65, "4805699e": 65, "4805702e": 65, "4805705e": 65, "4805708e": 65, "4805711e": 65, "4805714e": 65, "4805717e": 65, "4805720e": 65, "4805723e": 65, "4805726e": 65, "4805729e": 65, "4805732e": 65, "4805735e": 65, "4805738e": 65, "4805741e": 65, "4806128e": 65, "4806131e": 65, "4806134e": 65, "4806137e": 65, "4806140e": 65, "4806143e": 65, "4806146e": 65, "4806149e": 65, "4806152e": 65, "4806155e": 65, "4806158e": 65, "4806161e": 65, "4806164e": 65, "4806167e": 65, "4806170e": 65, "4806173e": 65, "4806176e": 65, "4806179e": 65, "4806182e": 65, "4806185e": 65, "4806188e": 65, "4806191e": 65, "4806194e": 65, "4806197e": 65, "4806200e": 65, "4806203e": 65, "4806206e": 65, "4806209e": 65, "4806212e": 65, "4806215e": 65, "4806218e": 65, "4806221e": 65, "4806224e": 65, "4806227e": 65, "4806230e": 65, "4806233e": 65, "4806236e": 65, "4806239e": 65, "4806242e": 65, "4806245e": 65, "4806248e": 65, "4806251e": 65, "4806254e": 65, "4806257e": 65, "4806260e": 65, "4806263e": 65, "4806266e": 65, "4806269e": 65, "4806272e": 65, "4806275e": 65, "4806278e": 65, "4806281e": 65, "4806284e": 65, "4806287e": 65, "4806290e": 65, "4806293e": 65, "4806296e": 65, "4806299e": 65, "4806302e": 65, "4806305e": 65, "4806308e": 65, "4806311e": 65, "4806314e": 65, "4806317e": 65, "4806320e": 65, "4806323e": 65, "4806326e": 65, "4806329e": 65, "4806332e": 65, "4806335e": 65, "4806338e": 65, "4806341e": 65, "4806344e": 65, "4806347e": 65, "4806350e": 65, "4806353e": 65, "4806356e": 65, "4806359e": 65, "4806362e": 65, "4806365e": 65, "480coordin": 67, "480num_st_lay": 67, "480west": 67, "481": 67, "481675": 46, "481982": 81, "481e": 65, "481j_parent_end": 67, "481south": 67, "481z": 67, "482": [46, 72, 73, 83, 84], "483": 73, "48359": 80, "48359column": 80, "48374655": 73, "48375397": 73, "484": [67, 73, 84], "48434403": 73, "48435021": 73, "484448256": 87, "485": 73, "485479535535": [72, 83, 84], "48548": [38, 41, 46, 72, 83, 84], "48567938": 73, "486": 73, "48637802": 39, "4864": 73, "48643687": 73, "48644143": 73, "48684994": 73, "48685308": 73, "486911": 46, "487": [61, 73], "48726019": 73, "48726435": 73, "48735222": 73, "48737022": 73, "48756839726296": 86, "48793556": 73, "488": 73, "48840649": 73, "488arrai": 73, "489": 73, "48936224": 73, "48945836": 73, "48946273": 73, "48960257": 73, "489xi_rho": 73, "48cft_sorghum": 80, "49": [23, 38, 41, 46, 61, 72, 80, 81, 84, 87], "49117019": 73, "49118142": 73, "492147": [38, 41, 46, 80, 84, 87], "49220683": 73, "49230075": 73, "4923025": 73, "49231": 41, "49269076e": 73, "49366889392412": 86, "49373412": 73, "494": 41, "49409571": 73, "49410785": 73, "494165": 81, "49446867": 73, "49448089": 73, "4945arrai": 73, "49462038": 73, "49462967": 73, "495": 41, "49520386": 73, "49520834": 73, "49536343": 73, "49536617": 73, "49545653": 81, "49589506": 73, "49594455": 73, "49594458": 73, "49611448": 73, "49612795": 73, "49636848": 73, "49642915": 73, "49738": 80, "497382": [41, 46, 84, 87], "497383": [38, 80], "4975": 81, "49770676": 73, "49770946": 73, "49777905": 73, "49778354": 73, "4978": 83, "49788316": 73, "4985": 68, "4985416": 86, "49895535": 81, "49901108": 73, "49901151": 73, "49903297": 73, "49912113": 73, "49917254": 73, "4991787": 73, "49929657": 73, "4993": 87, "49981401": 73, "49981748": 73, "49995467": 73, "49cft_irrigated_sorghum": 80, "49time": 46, "4arrai": [65, 80], "4baf": 61, "4cbf": 86, "4cf3": 41, "4cft_spring_wheat": 80, "4d": [73, 80], "4d1rk9dp": 41, "4d4e": 46, "4dask": 80, "4e": 61, "4flag_metgrid": 67, "4lat": 81, "4lev": 41, "4ltype_deep_lak": 80, "4n_": [72, 83], "4ne": [23, 72, 83], "4num_sm_lay": 67, "4pft": 80, "4rd": 13, "4refer": 17, "4south_north_stag": 67, "4th": [8, 16, 82], "4vegtyp": 80, "4version": 38, "4xarrai": 80, "4y": 80, "5": [0, 8, 11, 13, 17, 20, 23, 25, 28, 29, 30, 32, 36, 37, 38, 39, 41, 43, 46, 47, 61, 62, 65, 67, 68, 72, 73, 80, 81, 82, 83, 84, 85, 86, 87, 88, 90], "50": [20, 24, 37, 38, 41, 46, 61, 65, 67, 68, 72, 80, 83, 84, 87], "500": [7, 28, 37, 39, 41, 46, 61, 64, 68, 72, 81], "5000": [61, 86], "50000": [61, 83], "500000e": [39, 61, 68, 80], "500023cen_lon": 67, "500023stand_lon": 67, "50002593": 73, "5000e": 86, "50034415": 73, "5005749": 73, "500e": [72, 86], "50122301": 73, "50260723": 73, "50260979": 73, "502618": 46, "50274792": 73, "50275095": 73, "50307457": 73, "50307629": 73, "50321058": 73, "50350304": 73, "50361574": 73, "50364757": 73, "50365382": 73, "5040": 72, "5048": 73, "50493417": 73, "50501344": 73, "50509024": 73, "50509786": 73, "5051": 73, "5057565": 73, "50575825": 73, "5058": 73, "5065": [28, 39, 61, 68, 84, 87], "50703572": 81, "5073": 73, "507853": 46, "5082273": 73, "50832082": 73, "50832316": 73, "5089312": 73, "50893568": 73, "509154e": 41, "50960524": 73, "50965033": 73, "50966666": 73, "5097": 73, "50arrai": 72, "50c0": 83, "50cft_sugarbeet": 80, "50coordin": 87, "50cosp_ht": 72, "50cosp_sza": 72, "50gb": 46, "50k": 71, "50long_nam": 72, "51": [38, 41, 46, 61, 67, 68, 80, 81, 84, 87], "51028026": 73, "5102827": 73, "51029671": 73, "5103": 73, "51031117": 73, "51031365": 39, "51075928": 73, "51076364": 73, "510935e": [39, 61, 68], "51215224": 39, "5122": 20, "513088": [38, 80], "513089": [41, 46, 84, 87], "51309": 80, "51363979": 39, "513702e": [39, 61, 68], "51454096": 73, "51454733": 73, "51498191": 73, "51574038": 73, "51575231": 73, "51578852": 73, "516": 67, "51734334": 73, "51752643": 73, "51753427": 73, "51766482": 39, "51832460732984": [84, 87], "518325": [41, 46, 84, 87], "518326": [38, 80], "518335": 81, "51cft_irrigated_sugarbeet": 80, "52": [38, 41, 46, 61, 80, 84, 87], "520498": [41, 84], "52049824595451": 84, "52071202": 73, "5212416": 73, "5212arrai": 73, "5212xarrai": 73, "52166": 41, "523355": 41, "5235": 20, "52356": 46, "524": [38, 41, 46, 72, 83, 84], "525": 61, "525632": 84, "52682289": 73, "52684191": 39, "528": 83, "528796": 46, "52cft_sugarcan": 80, "53": [20, 38, 41, 46, 67, 72, 80, 81, 83, 84, 87], "5306396484375": [72, 83], "53064": [72, 83], "53403": 80, "534031": [38, 41, 46, 80, 84, 87], "534166": 81, "5347665250301": [72, 83, 84], "534767": [38, 41, 46, 72, 83, 84], "53510909": 81, "536615e": 41, "537500": [39, 68], "5375e": 86, "5386245362461": [72, 83, 84], "538625": [46, 72, 83, 84], "539": 72, "539167": 81, "539267": 46, "539795": 67, "53cft_irrigated_sugarcan": 80, "53long_nam": 46, "54": [38, 41, 46, 65, 72, 80, 81, 83, 84, 87], "540": 86, "540nv": 86, "540time": 86, "540yh": 86, "54131815": 81, "541946": 41, "542058": 84, "5427": 65, "544320": 67, "544503": 46, "545": [20, 39], "54608251505205": 86, "54721": 67, "54724076390266": [72, 83, 84], "547241": [38, 41, 46, 72, 83, 84], "54841014": 39, "549738": [38, 41, 46, 80, 84, 87], "54cft_sunflow": 80, "54unit": 41, "55": [20, 38, 41, 46, 61, 65, 67, 72, 73, 77, 80, 84, 87], "550": [20, 61], "5500": 61, "55000": 61, "550000e": [39, 61, 68], "5520": 72, "55385": 41, "554974": [41, 46, 84, 87], "554977": [38, 80], "55498": 80, "555": 61, "555317": [46, 72, 83, 84], "55531707406044": [72, 83, 84], "556095": [38, 41, 46, 72, 83, 84], "556095123291": [72, 83, 84], "55852034e": 73, "5599717795205": 86, "55cft_irrigated_sunflow": 80, "55e": 65, "56": [37, 38, 41, 46, 67, 68, 72, 80, 83, 84, 87], "560209": 46, "5625": [72, 83], "56250892": 39, "5625e": 86, "56390013e": 73, "565077e": 41, "565445": 46, "567": [46, 72, 83, 84], "5678": 15, "56789": 15, "568": 20, "56862": 81, "56cft_miscanthu": 80, "57": [38, 41, 46, 61, 67, 68, 72, 80, 81, 84, 87], "570": [20, 61], "570518": 41, "57068": 80, "570681": [38, 41, 46, 80, 84, 87], "571308": 41, "572502": 81, "573946e": [39, 61, 68], "575": 61, "5752": 20, "57591": 80, "575912": [38, 80], "575916": [41, 46, 84, 87], "5772": 51, "57748313": 83, "578": 84, "579": 20, "57cft_irrigated_miscanthu": 80, "57lat": 61, "57sourc": 80, "57time": 61, "58": [38, 41, 46, 61, 67, 73, 80, 84, 87], "580": 84, "580000e": 80, "581152": 46, "582": 83, "585833": 81, "58603923": 39, "5861487": 81, "586387": 46, "5868068933487": [72, 83, 84], "586807": [46, 72, 83, 84], "587499": 61, "58809725": 81, "58848746": 83, "58cft_switchgrass": 80, "58e": 65, "59": [20, 37, 38, 41, 46, 80, 81, 83, 84, 87], "59003": 67, "590625e": [72, 83], "59097600": 61, "59162": 80, "591621": [38, 80], "591623": [41, 46, 84, 87], "5919189453125": [72, 83], "59324513879179": 86, "593750e": [72, 83], "594819646328688": [72, 83, 84], "59482": [38, 41, 46, 72, 83, 84], "595": [38, 41, 46, 72, 83, 84], "59547974169254": [72, 83], "59548": [38, 46, 72, 83], "596859": 46, "596875e": [72, 83], "59741": 67, "5974696": 86, "59750403103993": 86, "597e": 61, "598e": 61, "59946073": 83, "599e": 61, "59cft_irrigated_switchgrass": 80, "5arrai": 72, "5cft_irrigated_spring_wheat": 80, "5coordin": [72, 80], "5ctype_wetland": 80, "5d3f": 37, "5de8302f": 46, "5dummi": 72, "5e": [28, 39, 61, 68, 86], "5gb": 73, "5long_nam": [41, 46, 72], "5ltype_wetland": 80, "5m": 15, "5min": 46, "5mt6p9na": 37, "5ncol": 72, "5standard_nam": 61, "5th": 85, "5time": 68, "5unit": 81, "5z_t": 68, "6": [0, 11, 12, 13, 14, 17, 20, 23, 28, 36, 37, 38, 39, 41, 44, 46, 47, 61, 65, 67, 68, 71, 72, 73, 80, 81, 83, 84, 86, 87, 88], "60": [20, 28, 36, 37, 38, 39, 41, 46, 61, 68, 72, 80, 84, 87], "600": [7, 8, 41, 61, 65, 68, 72, 84, 86, 87], "6000": [61, 72], "60000": 61, "600000e": 80, "6010": 20, "6011": 20, "6012": 20, "6013": 20, "6014": 20, "6015": 20, "602094": 46, "603077": 41, "6031": 68, "603321": 81, "605": 72, "607329": [38, 80], "60733": [41, 46, 84, 87], "609": [38, 41, 46, 72, 83, 84], "60cft_tropical_corn": 80, "60fd": 86, "60nlat": [39, 68], "60z_t": 68, "61": [36, 38, 41, 46, 68, 72, 80, 83, 84, 87], "61040262": 83, "61058124": 81, "611": 86, "61123": 73, "61129": 73, "61130": 73, "61131": 73, "61132": 73, "61187": 73, "61188": 73, "61189": 73, "61190": 73, "61191": 73, "61192": 73, "61193": 73, "61194": 73, "612": 86, "61218": 67, "61222": [38, 41, 46, 72, 83, 84], "612220004200935": [72, 83, 84], "612564": [38, 80], "612565": [41, 46, 84, 87], "61271724": 83, "61467574e": 73, "61500008": 83, "615e": 73, "616079": 41, "617104": 41, "6174": 46, "617801": 46, "618628": 41, "619": 86, "619997": 81, "61cft_irrigated_tropical_corn": 80, "61e": 65, "62": [28, 36, 38, 41, 46, 61, 80, 81, 83, 84, 87], "620": [20, 72], "620e": 72, "623": 83, "623037": 46, "624": 20, "62457": 67, "624991e": 61, "625": [41, 46, 61, 67, 72, 83], "62500": 61, "625190e": [39, 61, 68], "62589767000605": 86, "625e": [61, 86], "627670e": [39, 61, 68], "628272": [41, 46, 84, 87], "628273": [38, 80], "62cft_tropical_soybean": 80, "62nlat": 61, "63": [36, 38, 41, 46, 67, 72, 80, 81, 83, 84, 87], "63251636e": 73, "63332366": 81, "633507": [38, 80], "633508": [41, 46, 84, 87], "63351": 80, "637": 83, "6378137": 61, "638334": 81, "638743": 46, "63cft_irrigated_tropical_soybean": 80, "63ea4f6b110": 67, "64": [36, 38, 41, 46, 67, 73, 80, 83, 84, 86, 87], "640": [67, 72], "64150681863322": 86, "641507": 86, "641953": 46, "643": [38, 41, 46, 72, 83, 84], "64346569404006": [72, 83, 84], "643466": [38, 41, 46, 72, 83, 84], "643979": 46, "644546944648": [72, 83, 84], "644547": [38, 41, 46, 72, 83, 84], "648": 73, "6480": 72, "649": 73, "649001e": [39, 61, 68], "649093521": 84, "649215": [41, 46, 84, 87], "649216": [38, 80], "6493303": 39, "64time_period_freq": 80, "65": [36, 38, 41, 46, 61, 67, 73, 80, 84, 87], "650": [61, 73], "6500": 61, "65000": 61, "650984e": [39, 61, 68], "651": 73, "652": [46, 72, 73, 83, 84], "653": 73, "653168": 41, "65328": 17, "65379442": 81, "654": 73, "65445": 46, "654arrai": 73, "654xarrai": 73, "655": 73, "6550": 73, "655dask": 73, "655degre": 73, "65671145": 81, "658333": 81, "659686": 46, "659dbd": 18, "66": [38, 41, 46, 67, 80, 81, 84, 86, 87], "660": 46, "660833": 81, "663": 46, "66333": 81, "66407136": 81, "66443": 81, "6645321": 81, "664921": [41, 46, 84, 87], "664922": [38, 80], "66494518": 81, "665817": 41, "666573": 41, "666666": 81, "66666666666652": 86, "66666666666663": 86, "66666666666674": 86, "666667": 86, "66912293434143": [72, 83], "669123": [46, 72, 83], "66924": 41, "67": [20, 38, 41, 46, 61, 80, 81, 83, 84, 86, 87], "670157": [41, 46, 84, 87], "670158": [38, 80], "67016": 80, "67409912": 81, "675": 61, "675393": 46, "67542865": 81, "67624": 41, "676542e": [39, 61, 68], "67664": 67, "67749896645546": 84, "677499": [41, 84], "67780994884367": 86, "67781": 86, "679": 83, "679167": 81, "67c8ba06d7e1": 73, "67cartesian_axi": 86, "67ed": 87, "68": [38, 41, 46, 67, 80, 84, 86, 87], "680": 77, "680628": 46, "68204": 41, "6825": 81, "683412": 46, "683734": 41, "68396": 41, "684": 41, "68402": 41, "68405": 41, "68408": 41, "685863": [38, 80], "685864": [41, 46, 84, 87], "68630626": 39, "68677": 41, "6871747076511": [72, 83, 84], "687175": [38, 41, 46, 72, 83, 84], "6875": [72, 83], "68750895": 39, "6879": 41, "6890298": 81, "68903": 67, "6894720": 67, "689493": 41, "69": [38, 41, 46, 67, 80, 84, 86, 87], "6909084": 67, "691": [38, 41, 46, 72, 83, 84], "691099": [41, 46, 84, 87], "6911": 80, "691101": [38, 80], "6912960": 67, "69144862217053": 86, "6915": 41, "693": 83, "69321089982986": 84, "69321089982991": [72, 83], "693211": [46, 72, 83, 84], "69333": 81, "6951": 41, "695126": 41, "69570066e": 73, "6960": 72, "69626": 41, "696335": 46, "6963976": 86, "69962": 41, "69cell": 71, "6ae07e09": 87, "6ae5eeca": 87, "6arrai": [65, 72, 83], "6cft_winter_wheat": 80, "6ctype_urban_roof": 80, "6e": 86, "6formula_term": [38, 46, 84], "6h": 72, "6long_nam": [41, 72, 83, 84], "6ltype_urban_tbd": 80, "6mstorag": 83, "7": [8, 12, 13, 20, 22, 23, 28, 32, 36, 37, 38, 39, 41, 46, 51, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "70": [38, 41, 46, 61, 72, 80, 81, 84, 86, 87], "700": [37, 41, 61], "7000": 61, "70000": 61, "700000e": 80, "70063687": 81, "701": 41, "701418": [46, 72, 83, 84], "70141822099686": [72, 83, 84], "701483": 41, "7015": 41, "701571": 46, "7027306898779": 86, "7028ad57": 87, "70358949": 39, "704417": [46, 72, 83, 84], "70441716909409": [72, 83, 84], "705002": 81, "70557": 41, "70562482": 81, "70619098780386": 86, "706191": 86, "706806": [38, 41, 46, 80, 84, 87], "707499": 81, "708": 67, "71": [23, 38, 39, 41, 46, 65, 80, 84, 86, 87], "71143": 41, "712042": 46, "712509": 41, "71354076": 83, "713896": 65, "7139": 41, "71394044": 83, "71435405": 83, "71538": 41, "715866": [46, 72, 83, 84], "7158663570881": [72, 83, 84], "7162695": 83, "71717014": 81, "717277": 46, "719": 18, "71901211": 83, "71_v5oc_": 37, "71ctype_urban_sunwal": 80, "72": [38, 39, 41, 46, 61, 67, 72, 80, 81, 83, 84, 86, 87], "720": [18, 39, 61, 72], "72083": 81, "720lon": 61, "720nbound": 61, "721": 18, "72114": 37, "72176851": 83, "722": 18, "722513": [38, 41, 46, 80, 84, 87], "72287": 41, "723": 18, "72315176": 81, "72432654e": 73, "724998": 81, "725": [61, 81], "725760": 67, "72601591": 81, "7264988501736": 86, "726499": 86, "727749": [38, 41, 46, 80, 84, 87], "72775": 80, "72arrai": 46, "72ctype_urban_shadewal": 80, "72time": 46, "73": [38, 41, 46, 67, 80, 84, 86, 87], "730": [46, 72, 83, 84], "7308145": 81, "731667": 81, "7325": 81, "73276": 41, "7328": 41, "732984": 46, "73390508": 81, "734": 67, "73416": 41, "7343245": 46, "73467559512106": 84, "734676": 84, "73524335": 39, "7369": 41, "73822": 46, "73866267451815": 86, "738663": 86, "73881845": 39, "73881900e": 73, "73902120e": 73, "73ctype_urban_impervious_road": 80, "74": [23, 38, 41, 46, 80, 83, 84, 86, 87], "740": 72, "7411": 41, "742498": 81, "74269966208173": 86, "7427": 86, "743455": [41, 46, 84, 87], "743456": [38, 80], "7440": 72, "74423028": 81, "74424456": 39, "7452": 41, "74584418": 81, "74596231": 39, "74598346e": 73, "747": 41, "748": 83, "748688": [38, 80], "74869": 80, "748691": [41, 46, 84, 87], "74869143": 39, "74924": 41, "74cartesian_axi": 86, "74ctype_urban_pervious_road": 80, "75": [11, 38, 41, 46, 61, 67, 68, 72, 80, 83, 84, 87], "750": [61, 84], "7500": 61, "75000": 61, "75000884": 39, "7500e": 86, "75095784664154": 84, "750958": [41, 84], "750e": [72, 86], "7531": 41, "753227": 41, "75380113": 39, "753927": 46, "754790e": [39, 61, 68], "75581496e": 73, "755861": 65, "756": [20, 80], "75638": 41, "75662668307481": 86, "756e": 73, "757": [41, 80], "758": 80, "75817909": 81, "75820598": 81, "759": 80, "759162": 46, "75cft_c3_crop": 80, "75e": 86, "75read": 80, "76": [38, 41, 46, 65, 80, 81, 84, 86, 87], "760": 80, "760834": 81, "761108": 41, "761838": 41, "763": [38, 41, 46, 72, 83, 84], "764003e": [39, 61, 68], "764397": [38, 80], "764398": [41, 46, 84, 87], "76531982421875": [72, 83], "76532": [72, 83], "76542721": 39, "76566": 41, "766668": 81, "768": [46, 72, 83], "768244": 83, "768lon": [72, 83], "769634": 46, "77": [38, 39, 41, 46, 61, 67, 72, 80, 83, 84, 86, 87], "77116294": 81, "774869": 46, "77487": 41, "775": [61, 80, 81], "77614912": 81, "777498": 46, "777602": [23, 51, 72, 83], "777602dask": [72, 83], "777602n_b": [72, 83], "777602nbnd": 23, "777602time": [72, 83], "7786948084831": [72, 83, 84], "778695": [38, 41, 46, 72, 83, 84], "779167": 81, "78": [38, 39, 41, 46, 67, 80, 84, 86, 87], "780105": [38, 41, 46, 80, 84, 87], "782276e": [39, 61, 68], "78351267": 39, "7838": 41, "78462": 41, "785339": [38, 80], "78534": [41, 46, 80, 84, 87], "7862b3d1": 68, "788252e": [39, 61, 68], "789": 83, "78long_nam": 80, "79": [28, 38, 39, 41, 46, 80, 84, 86, 87], "790576": 46, "790833": 81, "7908477e": 46, "79141228": 81, "7920": 72, "79231": 41, "792501": 81, "7927": 41, "79362592": 81, "793729e": [39, 61, 68], "795000e": 80, "7953256": 86, "795812": 46, "796": [46, 72, 83, 84], "79984": 41, "7999996": 81, "79lat": 80, "79time": 80, "7arrai": [41, 72, 83], "7cft_irrigated_winter_wheat": 80, "7cosp_ht": 72, "7cosp_scol": 72, "7cosp_tau": 72, "7ltype_urban_hd": 80, "7nbnd": 72, "7r12h0e2": 73, "7th": [13, 82], "7z53ezhl": 37, "8": [8, 13, 17, 20, 23, 24, 28, 37, 38, 39, 40, 41, 44, 46, 47, 51, 61, 65, 66, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "80": [18, 37, 38, 41, 46, 47, 61, 67, 72, 80, 83, 84, 87], "800": [20, 23, 41, 61, 63, 72, 80, 83], "8000": 61, "80000": 61, "800000e": 80, "800497": 84, "80049747228622": 84, "80066936e": 73, "801046": [38, 80], "801047": [41, 46, 84, 87], "802": 20, "802017": 67, "80290802": 81, "80305": [8, 85, 91], "804": 65, "804b": 68, "805834": 81, "806": 65, "80628": 80, "806282": [38, 80], "806283": [41, 46, 84, 87], "807461": 65, "807896": 41, "8080973": 81, "80859345409614": 86, "80917": 41, "809306": 46, "80931": 46, "80972794": 81, "80num_metgrid_level": 67, "80plev": 67, "81": [38, 41, 46, 67, 80, 81, 83, 84, 87], "811518": 46, "8125": [72, 81, 83], "81250898": 39, "813268": 81, "81357": 81, "813915": 41, "81464622": 81, "816754": 46, "8170": 83, "8175": 81, "81arrai": 65, "81c8": 87, "81institut": 61, "82": [20, 38, 41, 46, 61, 67, 80, 83, 84, 86, 87], "820": [38, 41, 46, 72, 83, 84], "82123": [38, 41, 46, 72, 83, 84], "82123029232025": [72, 83, 84], "82124959": 81, "82143389007075": 86, "82199": [41, 46, 80, 84, 87], "821991": [38, 80], "8225": 81, "824a2fbf35c5": 41, "825": 61, "82659912109375": [72, 83], "827225": 46, "827367e": [39, 61, 68], "82760085": 39, "82794339": 39, "828333": 81, "82861895859241": [72, 83, 84], "828619": [38, 41, 46, 72, 83, 84], "82901055": 81, "829168": 81, "83": [38, 41, 46, 67, 80, 84, 87], "83101581": 81, "831667": 81, "832461": 46, "835219": [46, 72, 83, 84], "83521938323975": 84, "8352193832398": [72, 83], "83626334": 81, "836664": 81, "836668": 81, "837696": [38, 41, 46, 80, 84, 87], "83785642": 81, "83b6": 41, "84": [20, 38, 39, 41, 46, 65, 67, 80, 84, 87], "8400": 72, "84166116": 81, "84220832e": 73, "842932": [41, 46, 84, 87], "842934": [38, 80], "844004": 65, "844164": 81, "8445": 41, "844985": 41, "845": [46, 72, 83, 84], "8454": 84, "847059e": [39, 61, 68], "848168": 46, "848e": 72, "8493": 73, "8495195": 46, "84daf380": 67, "85": [23, 38, 41, 46, 61, 80, 84, 87], "850": [37, 41, 61], "8500": 61, "85000": 61, "850769": 41, "85247188": 81, "853333": 81, "853403": 46, "854837e": [39, 61, 68], "85500": 65, "8564": 41, "857103": 41, "85800": 65, "858014768480534e": 83, "8583686500788": [72, 83, 84], "858369": [38, 41, 46, 72, 83, 84], "858639": [38, 41, 46, 80, 84, 87], "858f": 86, "859": [38, 41, 46, 72, 83, 84], "85914054": 81, "85e875639611": 46, "86": [38, 41, 46, 80, 84, 86, 87], "86100": 65, "86198425": 83, "862913e": [39, 61, 68], "8633526563644": [72, 83], "86335265636444": 84, "863353": [46, 72, 83, 84], "863874": [41, 46, 84, 87], "863876": [38, 80], "86388": 80, "865248": 46, "86747661232948": [72, 83], "867477": [46, 72, 83], "868334": 81, "86849939e": 73, "86911": 46, "86923": 41, "87": [38, 41, 46, 61, 72, 80, 83, 84, 86, 87], "870": 80, "870025e": [39, 61, 68], "873": [46, 72, 83, 84], "87348859": 81, "874346": 46, "874991e": 61, "875": [41, 46, 61, 72, 83], "87500887": 39, "875083e": [39, 61, 68], "875e": [61, 86], "8761": 87, "8761bnd": 87, "8761ensembl": 87, "8761lat": 87, "876452e": [39, 61, 68], "876663": 81, "87719d972cea": 37, "8772": 73, "877499": 81, "877502": 81, "8777279": 81, "878": 83, "8787": [17, 37, 38, 61, 62, 67, 68, 73, 83, 84, 86, 87], "87935564e": 73, "87958": 80, "879581": [38, 41, 46, 80, 84, 87], "88": [38, 41, 46, 61, 67, 72, 80, 83, 84, 87], "880646": 65, "88441506": 39, "884736": [72, 83], "884736nv_a": [72, 83], "884736x777602": 83, "884817": 46, "885": 65, "885872": 86, "88587227082127": 86, "885arrai": 65, "886667": 81, "8869": 68, "88697765": 81, "887": [38, 41, 46, 72, 83, 84], "887072e": 80, "88787841796875": [72, 83], "8880": 72, "88835": 41, "88914068": 81, "889385e": [39, 61, 68], "88standard_nam": 61, "89": [38, 41, 46, 61, 72, 73, 80, 81, 83, 84, 86, 87], "890": 83, "890052": 46, "89091": 61, "8926": 73, "8942536": 86, "89458361e": 73, "895288": [38, 41, 46, 80, 84, 87], "89592331": 81, "896e": 72, "8975": 81, "899164": 81, "89ef705a": 86, "8c1af8bb535a": 83, "8cft_temperate_soybean": 80, "8e18": 83, "8e28f4e6653ecaa445c49b8638c8f808": 80, "8e4cb217": 73, "8fa4": 38, "8long_nam": [38, 39, 41, 46, 80, 84], "8ltype_urban_md": 80, "8mstorag": 80, "8standard_nam": 87, "8th": [8, 33, 34], "8xarrai": 80, "9": [13, 17, 18, 20, 23, 28, 32, 37, 38, 39, 41, 46, 51, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87, 88, 90], "90": [37, 38, 41, 46, 61, 67, 72, 80, 83, 84, 87], "900": [46, 61, 72, 83, 84], "9000": 61, "90000": 61, "900000e": 41, "900524": [38, 41, 46, 80, 84, 87], "901667": 81, "90200509": 81, "90238945": 81, "90286181": 39, "903259": 41, "90444": 41, "905759": 46, "905832": 81, "90800497": 81, "9080867022276": [72, 83, 84], "908087": [38, 41, 46, 72, 83, 84], "90m": 61, "90th": 63, "91": [38, 41, 80], "9101": 86, "9101yh": 86, "91055696415611": 86, "9108167588711": [72, 83, 84], "910817": [38, 41, 46, 72, 83, 84], "910995": 46, "91170191e": 73, "912": [38, 41, 46, 72, 83, 84], "914999": 81, "9151": 68, "91615": 46, "91615lat": 46, "91623": [41, 46, 84, 87], "916231": [38, 80], "91786": 41, "91838308": 39, "92": [46, 51, 61, 67, 81, 84], "9201": 73, "92146": 80, "921463": [38, 80], "921466": [41, 46, 84, 87], "92203252": 81, "92325": [41, 84], "92325001955032": 84, "924": [46, 72, 83, 84], "925": [41, 61, 81], "926702": 46, "92753362": 81, "93": [41, 67, 72, 83], "93077": 41, "931937": 46, "9327": 61, "936": [38, 41, 46, 72, 83, 84], "9360": 72, "937172": [38, 80], "937173": [41, 46, 84, 87], "9375": [72, 83], "938007128": 87, "94": [41, 46, 67, 68, 72, 83, 84, 86], "940000e": 80, "94095708e": 73, "941042": [46, 72, 83, 84], "94104236364365": [72, 83, 84], "942408": 46, "94264": 41, "94356": 41, "944": 83, "9446": 41, "94557": 41, "94571": 41, "94579": 41, "945831": 81, "94620384e": 73, "9465928": 81, "94685": 41, "947": [46, 72, 83, 84], "947357": 41, "947644": 46, "94797035": 83, "94814": 41, "94817018": 83, "948313e": 80, "94837698": 83, "94933473": 83, "94942394516579": 86, "94994384332117": 86, "949944": 86, "94lon": 41, "95": [39, 41, 61, 67, 83, 86], "950": 61, "9500": 61, "95000": 61, "950000e": 80, "9503": 41, "95070604": 83, "951687": 41, "95208424": 83, "952368": 41, "95282074809072": [72, 83], "95282074809074": 84, "952821": [46, 72, 83, 84], "95288": [38, 41, 46, 80, 84, 87], "95289509": 39, "95366172e": 73, "95549": 41, "957": [38, 41, 46, 72, 83, 84], "95809872": 39, "958115": [38, 41, 46, 80, 84, 87], "95895063e": 73, "95983548": 39, "959997": 81, "96": [83, 87], "9603567": 81, "96115": 41, "96127947e": 73, "963351": 46, "96368482e": 73, "96429148e": 73, "964462": [46, 72, 83, 84], "9644624069333": [72, 83, 84], "96504258": 39, "967": [46, 72, 83, 84], "96724": 41, "968586": 46, "968944e": [39, 61, 68], "9692100e": 46, "97": [41, 46, 61, 67, 83], "970": 68, "97177": 41, "97240884": 39, "97371054": 39, "973822": [38, 41, 46, 80, 84, 87], "97383": 41, "975": 61, "976": [38, 41, 46, 72, 83, 84], "97653799": 81, "976603e": [39, 61, 68], "976e": 67, "97706761e": 73, "97883158e": 73, "979057": [38, 80], "979058": [41, 46, 84, 87], "97906": 80, "979166": 81, "97958746": 81, "98": [46, 65], "980001": 81, "9801": 61, "981667": 81, "984": 67, "9840": 72, "984293": 46, "985": [46, 72, 83, 84], "989166": 81, "989280": 86, "989529": 46, "98arrai": [65, 81], "99": [17, 41, 61], "990000e": 80, "99121132e": 73, "99178698e": 73, "992": [38, 41, 46, 72, 83, 84], "992574": [38, 41, 46, 72, 83, 84], "992574095726": [72, 83, 84], "99296571e": 73, "9931816": 86, "99379444": 81, "99403876066208": [72, 83, 84], "994039": [38, 41, 46, 72, 83, 84], "9947": 68, "994764": [41, 46, 84, 87], "994766": [38, 80], "9948368e": 46, "995e": 46, "99756192": 81, "99817482e": 73, "998611": 41, "99954669e": 73, "999708": 41, "9a2e31b9": 83, "9am": [8, 91], "9arrai": [65, 83], "9b41": 46, "9bca": 38, "9cft_irrigated_temperate_soybean": 80, "9coordin": 80, "9ctype_vegetated_or_bare_soil": 80, "9mb": 61, "9standard_nam": 61, "9th": [8, 66, 70, 78, 82], "9unit": 83, "9x": [84, 87], "9x1": [38, 80, 84, 87], "9xarrai": 65, "A": [4, 6, 7, 8, 12, 13, 14, 17, 18, 20, 28, 29, 31, 36, 38, 39, 40, 41, 44, 45, 46, 48, 50, 53, 57, 61, 62, 63, 64, 68, 69, 71, 72, 74, 79, 80, 81, 83, 84, 86, 88, 90, 93], "AS": [46, 68], "And": [1, 8, 10, 12, 15, 55, 72, 73, 74, 76, 80, 83, 88, 92], "As": [8, 10, 17, 20, 28, 32, 37, 39, 45, 57, 61, 67, 68, 72, 84], "At": [1, 8, 11, 17, 24, 25, 37, 42, 43, 44, 46, 50, 57, 72, 90], "Be": [0, 24, 30, 50], "But": [11, 14, 15, 38, 42, 73, 74, 81, 84], "By": [8, 10, 14, 15, 28, 40, 50, 65, 67, 68, 86], "For": [7, 8, 11, 12, 13, 17, 23, 28, 29, 31, 37, 38, 39, 42, 44, 46, 50, 51, 57, 61, 64, 65, 68, 71, 72, 74, 75, 80, 83, 84, 86, 87], "If": [1, 4, 6, 7, 8, 11, 12, 13, 14, 15, 16, 19, 20, 21, 25, 26, 27, 28, 29, 31, 32, 33, 34, 35, 37, 39, 41, 42, 44, 45, 49, 50, 52, 53, 54, 55, 56, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 73, 74, 75, 78, 79, 80, 81, 82, 83, 84, 86, 87, 88, 90], "In": [7, 8, 10, 11, 12, 13, 14, 15, 18, 20, 21, 23, 25, 28, 29, 32, 37, 38, 39, 41, 42, 43, 44, 45, 46, 47, 50, 51, 52, 57, 58, 61, 63, 65, 66, 67, 68, 71, 72, 73, 81, 83, 84, 85, 86, 87, 88, 90, 91, 92, 93], "It": [4, 7, 8, 12, 14, 15, 19, 24, 25, 28, 33, 43, 45, 47, 50, 51, 53, 57, 61, 62, 67, 72, 73, 74, 81, 86, 87, 89, 90], "NO": 45, "No": [14, 20, 45, 69, 87], "Not": [10, 12, 15, 44, 81], "ONE": 69, "Of": 74, "On": [12, 28, 45, 59, 91, 92], "One": [7, 8, 11, 12, 14, 15, 20, 28, 29, 32, 37, 39, 57, 61, 62, 64, 65, 80, 88], "Or": [1, 50, 74, 79], "Such": 86, "That": [14, 15, 65, 73, 87, 90], "The": [0, 1, 2, 3, 6, 7, 8, 12, 13, 14, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 60, 62, 63, 66, 67, 70, 72, 73, 74, 75, 76, 77, 78, 79, 80, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93], "Their": 63, "Then": [8, 11, 15, 49, 68, 74, 86, 88], "There": [7, 8, 13, 15, 17, 22, 23, 24, 29, 30, 31, 35, 37, 39, 42, 46, 47, 48, 51, 55, 61, 62, 65, 69, 71, 80, 84, 85, 86, 87, 89, 90], "These": [7, 8, 26, 27, 28, 35, 36, 42, 44, 55, 57, 59, 61, 62, 63, 66, 67, 72, 80, 81, 86, 88], "To": [0, 1, 7, 8, 10, 12, 15, 17, 40, 42, 67, 71, 72, 73, 75, 80, 84, 86, 88], "Will": [14, 29, 69], "With": [7, 8, 15, 20, 23, 46, 81, 90], "_": [13, 17, 41, 44, 46, 61, 86], "_04": 61, "__init__": [8, 69], "__saonvw": 41, "__version__": [17, 73], "_appli": 83, "_array_dimens": 86, "_build": [1, 44, 50], "_chunksiz": [46, 87], "_climo": 41, "_compute_corn": 61, "_conda_root": 12, "_config": 44, "_coo": 80, "_deflatelevel": 87, "_endian": 87, "_pars": 20, "_shuffl": 87, "_storag": 87, "_streams_dict": 28, "_toc": 44, "_v6quk4w": 86, "a00dc4ddb19f": 38, "a1ea": 84, "a3": 46, "a386": 67, "a45a": 73, "a49fcaa9": 61, "a73eb1b3": 38, "a84b": 46, "a916e23c": 41, "a974": 87, "aa26": 38, "ab": 61, "ab59": 73, "abanihi": 71, "abf7": 37, "abil": [2, 8, 28, 29, 44, 57, 80, 88], "abl": [6, 8, 10, 11, 12, 14, 20, 23, 24, 25, 39, 44, 52, 63, 65, 67, 87, 88, 90], "abouali": 10, "about": [4, 6, 8, 10, 11, 12, 13, 14, 15, 16, 22, 23, 25, 29, 30, 32, 37, 39, 41, 45, 50, 56, 57, 61, 62, 63, 65, 68, 73, 75, 80, 81, 84, 86, 87, 88], "abov": [8, 12, 14, 32, 35, 38, 44, 47, 50, 71, 89], "absenc": 13, "absent": [39, 61, 68], "absolut": [29, 39], "absolute_filepath": 18, "abstract": [10, 29, 31], "academ": [8, 63, 64, 93], "academia": 63, "acb9": 67, "accept": [7, 53, 67, 87, 90], "access": [8, 12, 14, 23, 25, 28, 30, 37, 39, 43, 44, 57, 59, 61, 62, 65, 74, 80, 86, 88, 90, 92], "accessor": 25, "accompani": [8, 71], "accomplish": [17, 24, 44, 59, 61, 68, 74], "accord": [11, 45, 87], "account": [7, 12, 15, 35, 57, 68, 88], "accumul": [63, 67, 73], "accur": [23, 84], "acdd": 61, "achiev": [8, 10, 23, 88], "acknowledg": [8, 61, 64], "across": [2, 8, 11, 20, 24, 25, 31, 36, 38, 46, 47, 63, 67, 80, 87, 88], "act": 12, "action": [2, 15, 62, 74], "activ": [1, 2, 7, 8, 12, 19, 21, 26, 27, 28, 30, 31, 32, 33, 34, 40, 45, 49, 54, 55, 56, 58, 63, 66, 70, 71, 74, 76, 78, 90], "actual": [8, 12, 13, 15, 29, 37, 46, 59, 62, 72, 73, 83, 84, 86, 87], "actual_rang": [41, 81], "acuiti": 88, "ad": [1, 7, 8, 13, 28, 29, 30, 31, 38, 43, 44, 52, 62, 63, 65, 68, 71, 72, 74, 79, 86, 88, 90], "ad98": 86, "adam": 62, "adapt": [8, 17, 86, 87], "adaptor": 51, "adcbb9db": 73, "add": [0, 6, 7, 8, 11, 13, 15, 19, 23, 25, 26, 27, 28, 29, 35, 36, 37, 39, 41, 44, 47, 48, 51, 52, 62, 63, 64, 65, 67, 68, 69, 71, 81, 84, 86, 87, 88, 90], "add_colorbar": 81, "add_cyclic_point": 43, "add_ensemble_dim": 87, "add_featur": 81, "add_lat_lon_ticklabel": 81, "add_major_minor_tick": 81, "addint": 63, "addit": [0, 6, 8, 11, 20, 23, 29, 32, 37, 38, 39, 41, 43, 44, 57, 59, 61, 63, 71, 83, 86, 88, 90], "addition": 91, "address": [2, 6, 8, 12, 15, 21, 29, 58, 63, 66, 71], "addresse": 15, "adf": 24, "adhoc": 24, "adit": 75, "adjust": [31, 63, 68], "adminsitr": 88, "adminstr": 88, "adopt": 2, "adriaansen": [2, 92], "advanc": [2, 7, 8, 10, 16, 60, 67, 92], "advantag": [12, 67], "adventag": [8, 23], "advic": [6, 43], "advis": [15, 69], "advisor": 63, "ae4f": 84, "aeri": 63, "aerosol": 24, "afernoon": 63, "affect": [45, 73], "affili": 7, "aforement": 35, "after": [7, 8, 12, 13, 14, 15, 16, 23, 28, 43, 44, 46, 50, 57, 63, 66, 71, 72, 83, 84, 87, 90], "afternoon": [63, 88], "afterpuls": 63, "again": [13, 36, 50, 57, 67, 68, 74, 80, 84, 90], "against": [8, 41], "agenc": 63, "agenda": [8, 32, 85, 92], "aggreg": [8, 20, 23, 28, 38, 41, 42, 46, 62, 73, 84], "aggregationerror": 42, "agil": [8, 10], "agnost": 63, "ago": [8, 10, 50, 61, 63], "agre": [2, 15], "agrid_typ": 86, "aha": 73, "ahead": [25, 35, 39, 50, 77, 85], "ahijevych": 92, "aic": [20, 28], "aid": 93, "aim": [2, 7, 8, 30, 32, 71, 83, 84], "air": [17, 41, 46, 71], "air_temperatur": 71, "air_temperature_anomalyactual_rang": 46, "airs_01_climo": 41, "aka": [23, 67], "al": [8, 17, 31, 37, 72], "albani": 59, "albedo": [41, 67], "albedo12m": 67, "albedoarrai": 41, "albedoc": 41, "albedostagg": 67, "albeit": [8, 10, 16, 82], "alea": [8, 33, 34, 76, 77], "alfr": 63, "algorithm": [72, 73, 83], "align": [18, 39], "alk": 44, "all": [2, 6, 7, 8, 11, 12, 14, 15, 16, 20, 24, 25, 28, 29, 32, 36, 37, 38, 39, 40, 41, 42, 45, 46, 47, 48, 49, 53, 54, 55, 57, 60, 61, 62, 63, 68, 72, 73, 74, 77, 79, 83, 84, 85, 86, 87, 88, 91, 92, 93], "all_cas": 44, "all_dim": [46, 68], "all_vari": 44, "alloc": [4, 12, 24], "allow": [7, 8, 14, 17, 23, 25, 29, 38, 44, 52, 62, 63, 71, 72, 81, 83, 86, 87, 88], "almost": [15, 87], "alon": 13, "along": [7, 8, 11, 17, 25, 30, 31, 35, 50, 59, 65, 68, 73, 74, 78, 80, 83, 87], "alpha": [65, 81], "alreadi": [7, 8, 11, 15, 16, 18, 25, 38, 39, 49, 50, 61, 68, 69, 72, 80, 81, 82, 83, 84, 87, 88], "also": [6, 7, 8, 10, 13, 15, 20, 23, 24, 28, 29, 31, 32, 35, 36, 37, 38, 39, 40, 41, 43, 44, 46, 47, 48, 56, 57, 59, 61, 62, 65, 67, 68, 70, 73, 74, 76, 78, 79, 80, 81, 84, 85, 86, 88, 89, 90, 93], "alt": 65, "altern": [33, 34, 44, 83, 86, 90], "although": [8, 18, 38, 42, 52, 59, 64, 87], "altunta": 61, "alwai": [8, 11, 12, 14, 15, 23, 25, 53, 74, 83, 87, 88], "am": [8, 11, 12], "amazon": 8, "among": [8, 88], "amount": [8, 14, 22, 37, 43, 52, 61, 79, 87], "amp": 83, "amwg": [8, 24, 41], "amwg_author": 41, "amwg_creation_d": 41, "amwg_diagnost": [8, 41], "amwg_obs_dataset": 41, "an": [0, 2, 4, 6, 7, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 21, 22, 24, 25, 29, 30, 31, 32, 35, 36, 37, 39, 42, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 57, 58, 59, 60, 62, 63, 64, 67, 68, 69, 70, 71, 74, 75, 78, 79, 80, 81, 82, 85, 86, 87, 88, 90, 91, 93], "anaconda": [12, 30, 45], "anaconda3": [12, 45], "analyi": 71, "analys": [63, 73], "analysi": [2, 8, 10, 16, 18, 23, 25, 28, 29, 30, 31, 32, 37, 39, 43, 46, 47, 63, 67, 68, 70, 71, 77, 80, 81, 84, 85, 86, 90, 93], "analysis_config": 44, "analysisstagg": 67, "analyt": [2, 24], "analyz": [8, 32, 61, 87, 90], "ancillari": 47, "anderson": [2, 4, 8, 10, 11, 25, 26, 27, 32, 38, 46, 52, 66, 89], "andersy005": [4, 18, 25, 26, 27, 66], "angl": [67, 86], "anglestagg": 67, "ani": [7, 8, 12, 13, 14, 15, 20, 23, 36, 38, 44, 45, 46, 48, 50, 53, 62, 63, 68, 69, 71, 72, 75, 79, 83, 86, 87, 88, 90], "anissa": [8, 19, 34, 49, 76, 77, 92], "anissa111": [19, 34], "ann": 41, "ann_mean": 43, "annoi": [80, 86], "announc": [8, 27, 63], "annual": [8, 30, 31, 59, 61, 67, 81, 93], "annual_mean": 38, "anom": [46, 63], "anomali": [46, 63], "anomaly_cmip6": 46, "anomaly_smbb": 46, "anomalyhistori": 46, "anomalyparent_stat": 46, "anon": [38, 46, 68, 84], "anoth": [15, 17, 28, 31, 35, 39, 42, 47, 61, 63, 86, 88], "answer": [6, 8, 13, 25, 30, 31, 45, 47, 74], "anticip": 80, "anukesh": 87, "anyon": [8, 11, 16, 80, 82], "anyth": [8, 13, 14, 15, 29, 35, 45, 52, 69], "anywai": 74, "anywher": [11, 13, 14], "api": [8, 24, 25, 31, 38, 39, 62, 63, 67, 77, 80, 84], "apostroph": 14, "app": [22, 43, 52, 87], "appear": [7, 12, 28, 78, 86], "append": [13, 17, 18, 20, 39, 44, 61, 83], "appli": [8, 17, 24, 29, 36, 44, 46, 51, 61, 62, 63, 65, 68, 86], "applic": [2, 4, 8, 29, 57, 61, 62, 82, 83, 93], "apply_gufunc": 80, "apply_log10": 18, "apply_ufunc": [61, 73], "apply_unfunc": 47, "apply_variable_ufunc": 80, "apply_weight": 83, "applyin": 61, "appoint": [6, 7, 8], "appreci": 10, "approach": [2, 8, 23, 25, 29, 39, 71, 83], "appropri": [0, 7, 80, 86], "approv": [11, 79], "approx": 87, "approxim": [87, 90], "apr": [41, 87], "april": [7, 8, 21, 22, 55, 60, 83, 90], "ar": [0, 1, 2, 4, 6, 8, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 25, 26, 27, 28, 29, 31, 32, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 57, 58, 59, 60, 62, 63, 64, 65, 66, 67, 68, 69, 71, 72, 73, 74, 75, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 92, 93], "arang": [47, 53, 73, 80, 81], "arbitrai": 17, "arbitrari": [47, 80, 87], "arbitrarili": 47, "arc": 67, "archiv": [29, 42, 44], "arctic_grass": 80, "area": [23, 51, 61, 63, 72, 80, 83, 86, 88, 90], "area_a": [72, 83], "area_b": [72, 83], "areacello": 86, "areacello_bu": 86, "areacello_cu": 86, "areacello_cv": 86, "areacellocell_method": 86, "areastandard_nam": 86, "areasunit": 80, "aren": [8, 11, 13, 15, 29, 68, 81, 88], "arg": 80, "argentina": 40, "arguabl": [8, 64], "arguement": [25, 52], "argument": [11, 12, 15, 20, 31, 38, 39, 42, 48, 50, 53, 65, 71, 73, 74, 80, 83, 84], "ariabl": 38, "arm": 63, "arm_annual_cycle_twp_c2_cmbe_sound_p_f": 41, "aros": [8, 12, 13, 45, 48, 53], "around": [2, 7, 8, 10, 13, 14, 15, 16, 23, 24, 25, 30, 41, 42, 62, 63, 80, 83, 87, 90], "arrai": [7, 8, 11, 17, 18, 25, 28, 38, 39, 41, 43, 46, 53, 61, 62, 63, 65, 67, 68, 70, 72, 73, 81, 84, 86, 87], "arrang": 86, "arriv": 47, "arrow": [57, 88], "articl": [8, 17, 64, 80, 89], "artifact": 39, "artifici": 73, "as_compatible_data": 80, "as_numpi": 80, "ask": [8, 10, 15, 45, 57, 66, 75, 76, 77, 86, 90], "aso": 63, "aspect": [6, 25, 57, 63, 80], "aspir": [8, 59], "assembl": [8, 39, 42, 61], "assert": [11, 47, 61, 72, 83], "assert_allclos": [46, 68], "assert_equ": 80, "assert_ident": 17, "assertionerror": 17, "asset": [15, 18, 20, 25, 28, 31, 37, 38, 39, 41, 46, 61, 86, 93], "assign": [14, 18, 36, 37, 46, 50, 61, 64], "assign_attr": 81, "assign_coord": [7, 47], "assist": [6, 8, 16, 29, 88], "associ": [12, 29, 32, 38, 39, 63, 76, 86], "associated_fil": 86, "assum": [15, 35, 38, 47, 72, 80, 81], "assume_sort": 47, "assumpt": 87, "ast": [20, 28, 39, 41, 61], "asterisk": 45, "astronomi": 63, "astyp": [18, 37, 61, 80], "asymmetri": 67, "asynchron": [6, 78], "atla": 8, "atlant": 48, "atm": [7, 23, 28, 36, 37, 38, 41, 46, 51, 72, 83, 84, 86, 87], "atmintake_esm_attr": 38, "atmospher": [8, 11, 23, 28, 32, 37, 38, 40, 56, 59, 61, 72, 82, 83, 90], "atmosphere_hybrid_sigma_pressure_coordinateformula_term": [41, 72, 83, 84], "atmosphere_hybrid_sigma_pressure_coordinateunit": [38, 46, 84], "atoc8": [8, 12], "atown": 15, "attach": 71, "attempt": [7, 8, 15, 24, 42], "attend": [6, 8, 19, 21, 26, 27, 32, 40, 49, 54, 55, 62, 63, 85, 90], "attende": [8, 12, 32, 85, 90, 91], "attent": [8, 49, 73, 76], "attornei": 15, "attr": [7, 39, 43, 47, 61, 65, 67, 80, 83], "attribut": [7, 8, 11, 15, 17, 20, 23, 28, 36, 37, 38, 39, 41, 46, 51, 61, 65, 67, 68, 70, 72, 73, 80, 81, 83, 84, 86, 87, 90], "attribute_nam": [20, 28, 41], "attrit": [8, 79], "audienc": [8, 82], "audio": 57, "aug": 23, "august": [7, 8, 26, 27, 34, 82], "aureliana": 25, "austin": [8, 54, 55], "australia": 67, "authent": 57, "author": [0, 15], "auto": [0, 7, 68], "autoclosebracket": 45, "autocomplet": 45, "autom": [4, 31, 38, 91], "automat": [7, 8, 11, 12, 14, 15, 23, 44, 45, 69, 73, 80], "avail": [7, 8, 11, 20, 25, 29, 36, 37, 39, 46, 50, 57, 61, 64, 65, 69, 73, 74, 79, 80, 88, 89, 91], "averag": [7, 8, 11, 20, 30, 32, 38, 43, 44, 53, 61, 63, 86, 87, 93], "average_dt": 86, "average_dtunit": 86, "average_op_ncl": 41, "average_t1": 86, "average_t2": 86, "average_weighted_temp": 68, "averagedconvent": 17, "avg": 83, "avg_period": 81, "avoid": [7, 11, 17, 29, 67, 73, 81, 83, 84, 86, 87], "avtiv": 55, "aw": [8, 18, 25, 36, 38, 46, 62, 68, 84], "awai": [10, 20, 24, 25, 29, 31, 86], "await": [8, 61, 79], "awar": 74, "ax": [37, 48, 68, 80, 81], "axhlin": 47, "axi": [7, 11, 37, 46, 48, 61, 72, 73, 80, 81, 83, 86], "axvlin": 47, "azjmpit9": 41, "b": [0, 7, 11, 15, 23, 28, 38, 40, 41, 46, 51, 61, 67, 68, 72, 73, 80, 83, 84, 86, 87], "b06a26fe6702": 86, "b1850": [28, 39, 44, 84, 87], "b1850c5": [23, 51], "b20trc5cn": 83, "b20trc5cnbdrd": [7, 38], "b37f404b": 83, "b8ab": 37, "b9e8": 73, "back": [6, 8, 10, 17, 20, 24, 42, 61, 63, 72, 73, 74, 83, 84], "backbon": 63, "backend": [20, 25, 28, 48, 61, 67, 84, 86], "backend_kwarg": 38, "backfir": 87, "background": [8, 11, 18, 45, 82], "backward": 29, "bad": [8, 15, 31, 45, 84], "badg": 64, "bag": 86, "balanc": [25, 41], "bam": [8, 46], "banihirw": [2, 4, 8, 10, 25, 26, 27, 32, 38, 46, 52, 66, 89], "bank": 15, "bar": [0, 7, 50, 88], "baranova": 61, "bare": 44, "barghini": 25, "barlei": 80, "barrier": [2, 77], "baschrc": 45, "base": [7, 8, 11, 17, 23, 24, 25, 30, 31, 35, 40, 43, 44, 45, 46, 47, 51, 61, 63, 64, 69, 72, 80, 81, 83, 84, 86, 90, 91, 93], "base64": 86, "base_tim": 65, "baselin": [39, 86], "baseline_d": 39, "baseline_plot": 39, "bash": 12, "bash_profil": 12, "basi": [8, 28, 32], "basic": [7, 8, 16, 31, 35, 44, 45, 60, 62, 65, 75, 76, 77, 82, 83, 85], "basin": 18, "bat": 65, "batch": 8, "bb5b27d0821608d3fc5037525bd2f985t": 83, "bbf4": 83, "bcb991af9ed1": 37, "becasu": 87, "becaus": [8, 15, 16, 18, 43, 69, 72, 73, 74, 79, 80, 83, 86, 87, 90], "becom": [8, 10, 25, 29, 63, 64, 68, 81, 88], "bedrock": 80, "been": [0, 8, 11, 12, 20, 28, 29, 31, 32, 37, 38, 61, 73, 74, 80, 84, 87, 88], "befor": [0, 8, 12, 14, 16, 19, 21, 23, 26, 27, 37, 38, 39, 41, 44, 45, 49, 51, 55, 59, 61, 63, 66, 67, 72, 74, 75, 76, 77, 80, 81, 87, 88], "beforehand": 75, "began": [8, 29], "begin": [7, 8, 10, 13, 16, 35, 47, 48, 61, 62, 63, 80, 82, 84], "behav": [14, 53], "behavior": [45, 63], "behaviour": 87, "behind": [12, 63], "being": [6, 8, 11, 13, 14, 15, 20, 23, 24, 25, 29, 32, 37, 44, 45, 47, 59, 61, 66, 67, 68, 74, 80, 81, 88, 90], "believ": [8, 10, 15, 16, 90], "below": [8, 14, 18, 22, 30, 31, 32, 37, 38, 39, 42, 44, 51, 59, 62, 63, 64, 65, 67, 80, 81, 89, 92, 93], "benchmark": [8, 25, 32, 68], "benefici": [19, 21, 33, 49, 55], "benefit": [8, 10, 11, 23, 83, 84, 88], "bennett": 25, "benoit": 25, "berk": 63, "best": [2, 6, 7, 8, 10, 14, 29, 64, 83, 87], "beta": 24, "better": [8, 10, 15, 20, 29, 44, 63, 65, 71, 74, 80, 82], "betti": 63, "between": [2, 4, 8, 11, 14, 15, 39, 59, 61, 62, 67, 68, 74, 81, 88], "beyond": [2, 16, 24, 35], "bfe1": 68, "bgc": [7, 18], "bgcolor": 61, "bhist": 72, "bhistc5": 72, "bhistcmip6": 84, "bhistsmbb": 87, "bi": 6, "bia": [11, 63], "big": [2, 7, 10, 24, 25, 31, 40, 62, 63, 73, 87], "bigger": [80, 87], "bilinear": [72, 83, 90], "bilinear_1x777602_768x1152_peri": 72, "bilinearconvent": [72, 83], "bilinearxarrai": 72, "billion": 63, "bin": [12, 22, 29, 43, 45, 52, 87], "binari": [63, 65, 86], "binder": [8, 26, 27, 33, 34, 40, 56, 59, 66, 70, 78], "bio": 88, "biogeochemistri": [43, 44], "biogeochemistry_": 44, "biomass": [37, 46], "bit": [8, 10, 39, 61, 63, 65, 73, 80, 81, 86, 87], "black": [63, 80], "blank": 15, "blin": 38, "blind": 38, "block": [8, 12, 13, 15, 44, 50, 62, 74, 79, 80, 83, 86, 88], "blog": [1, 6, 8, 11, 17, 23, 25, 29, 39, 44, 50, 68, 73, 76, 77, 81, 83, 87, 88, 92], "blogpost": 87, "blue": 47, "bnd": [46, 87], "board": 63, "boat": 40, "bockelman": 92, "bodi": 15, "bog": 47, "bokeh": [20, 23, 38, 39, 41, 46, 61, 65, 67, 68, 84], "bolster": 10, "bonnland": 10, "book": [7, 88], "boolean": 15, "border": 23, "born": 10, "both": [2, 6, 8, 10, 20, 23, 24, 29, 30, 37, 41, 46, 50, 51, 59, 65, 67, 72, 74, 86], "bottleneck": [47, 73], "bottom": [12, 38, 41, 57, 67], "boulder": [8, 37, 63, 65, 82, 85, 91], "bound": [7, 11, 38, 46, 61, 68, 81, 84, 86], "boundari": [12, 48, 63, 68, 86], "boundaries_chunks": 46, "boundariescalendar": 86, "boundsarrai": 61, "boundsunit": 84, "bovi": 25, "box": [8, 46, 67, 71], "boxplot": 30, "boxunit": 46, "boyer": 61, "br": 18, "bracket": [13, 15], "branch": [0, 8, 35, 37, 44, 61, 90], "branch_tag": 80, "break": [17, 23, 24, 63, 74, 77], "breakout": [24, 75, 77, 85, 90], "breindel": 62, "breviti": 17, "breweri": 40, "brian": [10, 32, 92], "bridg": 63, "brief": [6, 8, 15, 59, 90, 92], "bring": [8, 18, 24, 29, 30, 31, 88], "broad": 63, "broadcast_to": 41, "broaden": 2, "broader": [8, 63, 89], "broadleaf_deciduous_boreal_shrub": 80, "broadleaf_deciduous_boreal_tre": 80, "broadleaf_deciduous_temperate_shrub": 80, "broadleaf_deciduous_temperate_tre": 80, "broadleaf_deciduous_tropical_tre": 80, "broadleaf_evergreen_shrub": 80, "broadleaf_evergreen_temperate_tre": 80, "broadleaf_evergreen_tropical_tre": 80, "broadli": 29, "broke": 90, "brought": [8, 29, 30, 31], "browser": [1, 45, 50, 56], "bruyer": 67, "bruyerec": 67, "bsf": 44, "bssp370smbb": 87, "bsw": 80, "bu": 86, "bubbl": [36, 50], "budget": [10, 29, 38, 63], "buffer": 86, "bug": [8, 74, 80, 83, 90], "buggi": 73, "build": [2, 8, 23, 25, 29, 32, 36, 39, 45, 61, 63, 80, 81, 86, 90, 91, 92, 93], "builder": [20, 28, 41], "built": [1, 8, 12, 18, 23, 28, 39, 41, 44, 50, 53, 63, 69, 73, 83], "bullet": 44, "bump": 86, "bunch": [31, 83], "burn": 46, "buseck": [4, 32], "busi": [15, 88], "button": [0, 21, 33, 34, 40, 50, 56, 58, 59, 60, 66, 70, 78], "bwr": 81, "by_coord": [7, 17, 87], "byte": [17, 38, 39, 41, 46, 61, 62, 67, 68, 72, 73, 80, 83, 84, 86, 87], "c": [7, 20, 23, 28, 36, 44, 45, 46, 47, 50, 52, 61, 63, 68, 71, 86], "c190529": 80, "c33f": 84, "c3_arctic_grass": 80, "c3_crop": 80, "c3_irrig": 80, "c3_non": 80, "c4_grass": 80, "c5c7baf9": 41, "c761": 86, "ca": 46, "cach": [30, 45, 86], "caco3_flux_100m": [18, 44], "cacti": 40, "calc": 63, "calc_wind_spe": 38, "calcul": [8, 20, 23, 24, 30, 31, 41, 44, 61, 63, 67, 73, 78, 80, 86, 90], "calendar": [8, 11, 28, 39, 40, 41, 46, 61, 68, 72, 79, 83, 84, 86, 87, 88], "calendar_typ": 86, "call": [7, 8, 12, 13, 14, 15, 28, 30, 31, 39, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 73, 79, 80, 83, 86, 87], "calucl": 81, "cam": [7, 8, 23, 28, 32, 37, 38, 41, 51, 72, 84, 87, 90], "cam5": 7, "camaraderi": [8, 88], "camcas": [23, 72, 83, 84, 87], "came": [8, 24, 64, 83, 90], "cami": 83, "campaign": [8, 20, 37, 40, 72, 83, 86], "camron": [2, 8, 32, 58, 78, 89, 92], "camtime_period_freq": 84, "camtitl": 38, "can": [0, 1, 4, 6, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 20, 21, 22, 23, 24, 28, 29, 31, 35, 36, 37, 38, 39, 40, 41, 43, 44, 45, 46, 47, 48, 50, 51, 53, 54, 57, 58, 59, 61, 62, 63, 64, 65, 66, 67, 68, 69, 71, 72, 73, 74, 75, 76, 77, 79, 80, 81, 83, 84, 86, 87, 88, 89, 90, 92], "canfra": 67, "cannot": [8, 11, 53, 57, 73, 80, 86, 87, 88], "canon": 69, "canopi": 67, "canva": 18, "capabl": [8, 17, 23, 24, 44, 72, 80], "capac": [2, 8, 17, 63, 88, 89], "captain": 40, "captial": 37, "caption": 44, "captur": 73, "carbon": 80, "care": [15, 45, 68, 81], "career": [40, 63], "carpentri": 25, "cart": 81, "cartesian_axi": 86, "cartopi": [8, 19, 23, 24, 31, 41, 43, 60, 80, 81, 93], "cartopy_tutori": 21, "case": [4, 7, 8, 12, 18, 20, 23, 25, 28, 31, 37, 38, 39, 41, 42, 43, 44, 46, 47, 50, 51, 61, 62, 68, 69, 72, 73, 77, 80, 81, 83, 84, 86, 87, 88, 90], "case_compare_d": 39, "case_compare_plot": 39, "case_data_path": 44, "case_i": 50, "case_titl": 80, "case_to_compar": 39, "casenam": [18, 39, 86], "casper": [4, 6, 7, 8, 25, 29, 30, 32, 37, 41, 43, 57, 62, 84, 87], "cassava": 80, "cat": [8, 28, 36, 37, 42, 74, 78], "cat_so": 42, "cat_thetao": 42, "catalog": [8, 25, 30, 31, 32, 38, 39, 42, 43, 44, 61, 86], "catalog_csv": 44, "catalog_fil": [42, 43], "catalog_json": 44, "catalog_subset": [38, 39, 46], "catalogu": 37, "catastroph": 63, "catch": [8, 16], "categori": [8, 29, 50, 67, 69], "categorydescript": 67, "categorystagg": 67, "catlaog": 39, "caus": [7, 14, 25, 45, 63, 68], "caution": 38, "cbar": 81, "cbar_kwarg": 80, "ccd4a03a": 84, "ccr": [23, 41, 43, 80, 83], "ccsm": [28, 39, 61, 68, 83], "cd": [0, 19, 26, 27, 33, 34, 40, 50, 55, 56, 66, 70, 78], "cdf": [41, 65], "cdf_d": 65, "cdf_kwarg": [20, 28, 39, 41, 43, 61], "cdg": 7, "cdi": 87, "cdo": 87, "cdx": 67, "cecil": 41, "ceilomet": 63, "cell": [0, 17, 18, 20, 38, 43, 45, 46, 48, 50, 53, 67, 68, 71, 73, 80, 86], "cell_area": [46, 86], "cell_areaunit": 86, "cell_corner_lat": 61, "cell_corner_lon": 61, "cell_measur": 86, "cell_method": [28, 38, 39, 41, 46, 61, 68, 80, 81, 84, 86, 87], "cell_typ": 44, "cells_to_keep": 44, "celsiu": [38, 65, 81], "center": [2, 6, 8, 24, 37, 39, 41, 56, 59, 61, 72], "centerarrai": 81, "centercom": 41, "centerconvent": 46, "centerposit": 86, "centerunit": 17, "centervers": 46, "centimet": [36, 61], "centimetersaxi": 61, "centimetersposit": [39, 61], "centimetersvalid_max": [61, 68], "central": 63, "centuri": 38, "cere": 41, "ceres2_01_cl": 41, "ceres2_01_climo": 41, "ceres2_04_climo": 41, "ceres_07_climo": 41, "cerfac": 42, "certain": [8, 23, 28, 86], "certainli": [8, 15, 74], "certif": 12, "cesm": [8, 20, 28, 29, 32, 37, 38, 39, 44, 46, 47, 51, 61, 67, 68, 72, 90], "cesm01host": 23, "cesm1": [36, 38, 43], "cesm1_1_2_len": 38, "cesm2": [8, 31, 32, 44, 47, 50, 72, 84], "cesm2_le_reference_fil": 84, "cesm2l": [46, 68], "cesm_data_catalog": 41, "cesm_data_catalog_subset": 41, "cesm_file_format": 44, "cesm_history_build": 20, "cesm_input": [84, 87], "cesm_monthly_mean_temperatur": 41, "cesm_monthly_temperature_plot": 41, "cesm_seasonal_mean_temperatur": 41, "cesm_seasonal_temperature_plot": 41, "cesm_test_catalog": 50, "cesm_test_data": 28, "cesm_timeseries_build": 20, "cesmdata": [61, 90], "cesml": [7, 36], "cf": [7, 8, 11, 17, 23, 28, 32, 38, 39, 46, 51, 61, 65, 67, 68, 72, 80, 83, 84, 87], "cf_xarrai": [7, 61], "cfad": 72, "cfnoleap_to_datetim": 11, "cft_irrigated_tropical_corn": 80, "cft_irrigated_tropical_soybean": 80, "cft_lb": 80, "cft_tropical_soybean": 80, "cft_ubctype_landic": 80, "cftime": [7, 17, 23, 38, 41, 43, 46, 61, 68, 72, 80, 83, 84, 86, 87], "cftime_rang": 30, "cftimeindex": [11, 72, 83, 84, 86, 87], "cgd": [2, 8, 10, 18, 28, 30, 31, 32, 37, 39, 47, 61, 68, 70, 80, 83, 86], "ch4": [72, 83, 84], "ch4vmr": [72, 83, 84], "chain": 73, "chair": 76, "challeng": [2, 8, 10, 16, 29, 41, 57, 67, 72, 74, 88], "champaign": 40, "chan": 63, "chanc": 90, "chang": [0, 1, 8, 12, 15, 19, 22, 26, 27, 35, 38, 42, 43, 45, 50, 52, 53, 61, 64, 67, 73, 90], "channel": [6, 7, 20, 29, 40, 92], "chapman": 77, "chapter": [12, 44], "charact": [14, 87], "character": 63, "chase": [8, 74], "chat": [8, 29, 57], "cheap": 73, "cheaper": 63, "check": [6, 7, 8, 12, 15, 18, 19, 21, 23, 24, 26, 27, 28, 29, 30, 31, 32, 35, 37, 39, 40, 43, 44, 45, 49, 50, 51, 53, 54, 55, 56, 57, 58, 59, 62, 63, 64, 65, 66, 68, 70, 73, 77, 78, 81, 84, 85, 87, 88], "checker": 4, "checkout": [0, 7, 20, 44], "cheet": 7, "chell": 25, "cherian": [2, 8, 17, 25, 32, 70, 76, 77, 89], "cherukuru": 92, "cheyenn": [8, 25, 29, 52, 57, 80], "cheyenneusernam": 80, "child": [8, 15, 36], "chill": 16, "chlorophyl": 43, "chmielowiec": [76, 77, 92], "choic": [7, 87], "choke": 69, "choos": [7, 12, 37, 41, 48, 50, 61, 88], "chore": 74, "chrome": 45, "chunk": [7, 8, 17, 20, 25, 28, 37, 38, 39, 41, 43, 46, 47, 61, 62, 67, 68, 72, 73, 80, 84, 86], "chunk_dict": 20, "chunk_slic": 17, "chunk_strategi": 20, "chunked_dim": 73, "chunksiz": [17, 28, 38, 39, 41, 43, 46, 47, 61, 67, 68, 72, 73, 80, 83, 84, 86, 87], "chunktyp": [41, 46, 68, 72, 73, 80, 83, 87], "churn": [8, 10], "cice": [18, 20, 28], "cindi": 67, "cisl": [2, 4, 6, 8, 10, 30, 31, 32, 43, 91], "citat": 8, "cite": [8, 63], "citru": 80, "ckdtree": 51, "cl": 80, "clabel": 68, "clai": 67, "clarifi": 13, "clash": 14, "class": [8, 13, 32, 36, 60, 69, 72, 74, 83], "classroom": [75, 76], "classrooom": 77, "clat": 67, "clayfrac": 67, "clean": [12, 14, 16, 45, 65], "cleaner": 74, "clear": [14, 24, 39, 41, 47, 72, 87], "clearli": 15, "clearski": 36, "cleint": 62, "click": [0, 1, 6, 7, 12, 19, 21, 26, 27, 33, 34, 35, 40, 44, 49, 50, 52, 54, 55, 56, 57, 58, 59, 60, 62, 66, 70, 71, 78, 82, 88], "client": [8, 15, 17, 20, 22, 37, 38, 39, 41, 43, 46, 47, 52, 61, 62, 67, 68, 73, 84, 86, 87, 88], "clim": [68, 72], "climat": [8, 23, 36, 37, 38, 40, 41, 61, 62, 63, 73, 87], "climatenet": 83, "climatolog": 61, "climatologi": [20, 61, 80, 81, 93], "climatologiescdm_data_typ": 61, "climatology_averag": 81, "climatology_bound": 61, "climatology_boundsarrai": 61, "climo": 41, "climpr": 7, "clinic": 29, "clip": 7, "clipboard": [21, 58, 66], "clm2": 80, "clm5_param": 80, "clockwis": 86, "clone": [0, 19, 21, 26, 27, 28, 33, 34, 35, 40, 55, 56, 58, 66, 70, 78], "clong": 67, "clong_nam": 17, "close": [12, 15, 43, 46, 61, 63, 73, 79], "closer": 74, "closest": 37, "cloud": [8, 24, 25, 29, 31, 41, 46, 59, 86, 91, 92], "cloudsat_10_climo": 41, "cloudsatcosp_07_climo": 41, "clue": 80, "cluster": [7, 8, 17, 22, 25, 41, 47, 52, 61, 63, 73, 86], "clyne": [2, 92], "cm": [28, 39, 61, 67, 68, 80], "cm6": 42, "cm_config": 45, "cmap": [23, 38, 39, 41, 61, 67, 68, 72, 81], "cmap_sequenti": 80, "cmip": [37, 41, 42, 72], "cmip6": [8, 25, 28, 32, 37, 41, 46, 68, 72, 84, 87], "cmip6_plot": 46, "cnrm": 42, "co": [8, 17, 46, 76, 85, 91], "co2": [72, 83, 84], "co2vmr": [72, 83, 84], "coalesc": 29, "coars": 90, "coastlin": [23, 38, 41, 67, 72, 80, 81], "cocoa": 80, "code": [0, 2, 4, 6, 8, 12, 13, 15, 21, 23, 24, 25, 29, 32, 35, 40, 45, 47, 50, 58, 62, 63, 64, 66, 69, 71, 73, 80, 82, 83, 85, 87, 90, 91], "code_obj": [37, 41], "codecel": 45, "coder": [8, 74], "coeff": 73, "coeffici": [46, 72, 73, 83, 84], "coffe": 80, "coil": [8, 62], "col": [20, 28, 36, 39, 42, 43, 46, 50, 65, 68, 72, 80, 83], "col_sub": 43, "cole": 63, "collabor": [2, 6, 8, 10, 24, 25, 29, 35, 37, 44, 46, 50, 59, 63, 77, 83, 85, 88, 93], "collaboratori": 63, "colleagu": [8, 15, 17, 88], "collect": [2, 7, 8, 12, 14, 29, 30, 32, 37, 38, 40, 41, 42, 43, 44, 61, 63, 65, 67, 68, 72, 78, 80, 84, 86], "collid": 10, "colobar": 68, "color": [43, 46, 48, 61, 62, 63, 65], "color_level": 61, "colorado": [8, 12, 37, 65, 82], "colorbar": [23, 31, 39, 48, 81], "colormap": [8, 23, 48, 61], "cols1d_act": 80, "cols1d_gi": 80, "cols1d_itype_col": 80, "cols1d_itype_lunit": 80, "cols1d_ixi": 80, "cols1d_jxi": 80, "cols1d_lat": 80, "cols1d_li": 80, "cols1d_lon": 80, "cols1d_wtgcel": 80, "cols1d_wtlunit": 80, "columbia": 32, "column": [8, 18, 20, 23, 28, 36, 37, 39, 41, 42, 46, 47, 51, 63, 65, 68, 80], "column_widget_typ": 18, "columncolab": 63, "columnflag_valu": 80, "com": [0, 12, 18, 19, 21, 23, 26, 27, 28, 33, 34, 35, 36, 38, 40, 46, 50, 55, 56, 58, 63, 66, 67, 70, 73, 78, 83, 87], "combin": [7, 8, 17, 20, 23, 44, 46, 61, 63, 67, 73, 84, 88], "combine_stream_jsons_as_group": 86, "combine_xxx": 87, "come": [8, 11, 25, 29, 41, 46, 47, 51, 59, 62, 63, 68, 74, 75, 76, 86, 91], "comfort": 12, "comm": [37, 38, 41, 46, 61, 67, 68, 73, 83, 84, 86, 87], "comma": 14, "command": [8, 12, 21, 35, 45, 48, 55, 58, 60, 68], "commandnotfounderror": 12, "comment": [6, 17, 41, 45, 46, 61, 80], "commit": [0, 35, 88], "committe": 76, "common": [2, 7, 8, 13, 15, 30, 31, 32, 35, 36, 50, 57, 60, 62, 68, 72, 73, 74, 80], "commonli": [8, 73], "commun": [4, 8, 10, 11, 15, 20, 23, 25, 28, 29, 30, 36, 37, 41, 46, 59, 62, 64, 72, 77, 78, 83, 84, 87, 88, 90, 92], "comp": [7, 8, 34, 41, 77], "comp_i": [36, 50], "comp_tutori": 33, "compani": 15, "compar": [7, 8, 11, 32, 46, 47, 80, 81], "compare_case_nam": 44, "comparison": [8, 41, 44, 46, 62], "compat": [7, 20, 28, 41, 43, 61, 84, 87], "compil": [8, 12, 13, 14, 44, 45, 48, 53, 69, 77, 89], "complain": 80, "complement": 6, "complet": [8, 12, 13, 17, 22, 40, 59, 62, 63, 67, 71, 74, 75], "complex": [10, 25, 29, 62, 63], "compliant": [8, 67], "complic": [14, 80], "compon": [2, 8, 18, 20, 24, 25, 28, 37, 38, 39, 41, 46, 61, 62, 68, 86, 93], "componenthistori": 61, "componentintake_esm_varnam": 39, "componenttime_period_freq": 68, "compress": [20, 28, 38, 41, 86], "compressor": 86, "compris": [2, 8, 28, 31], "compset": 28, "comput": [2, 6, 7, 8, 10, 12, 16, 22, 23, 38, 43, 44, 47, 51, 53, 56, 59, 63, 67, 68, 72, 73, 74, 80, 84, 86, 88, 93], "computation": [43, 61], "compute_temp_100m": 43, "con": [15, 67], "concat": [18, 20, 39, 43, 46, 61], "concat_dim": [7, 65, 67, 84, 86, 87], "concaten": [7, 37, 39, 42, 43, 80], "concept": [15, 67], "conceptu": 25, "concern": [6, 88], "concurr": [20, 28, 71], "cond": [46, 68], "conda": [1, 8, 12, 15, 19, 21, 23, 26, 27, 28, 29, 33, 34, 36, 40, 44, 45, 49, 50, 52, 54, 55, 56, 58, 61, 66, 69, 70, 71, 72, 78, 83, 84, 86, 88, 92], "conda_environ": 21, "conda_prefix": 71, "conditionsstandard_nam": 41, "conduct": [40, 85, 91], "confer": [8, 16, 88, 89, 90], "confess": 11, "config": [7, 12, 22, 37, 43, 44, 45, 52, 67, 84], "configmanag": 45, "configur": [8, 12, 20, 22, 43, 52, 71], "confirm": 53, "conflict": [0, 8, 15, 35, 79, 88], "conform": [43, 72], "confus": [8, 15, 88], "conjunct": [29, 65], "conl": 67, "connect": [6, 7, 8, 36, 37, 38, 41, 46, 57, 61, 63, 67, 68, 73, 83, 84, 86, 87, 88, 89], "conserv": [61, 90], "conservativexarrai": 61, "consid": [10, 11, 13, 25, 47, 68, 74, 77, 81, 84, 85, 86, 90], "consist": [6, 8, 14, 17, 38, 63, 67, 73, 88, 92], "consistentsgh": [23, 72, 83], "consolid": [8, 46, 76, 84, 86], "consolidate_metadata": 84, "conss": 67, "constant": 87, "constantli": 64, "constitut": 2, "construct": [8, 28, 31, 37, 38, 39, 41, 42, 46, 61, 63, 67, 69, 73], "consult": 6, "consum": 83, "consumpt": 73, "contain": [7, 11, 13, 14, 28, 29, 36, 39, 44, 45, 59, 61, 69, 71, 81, 83, 86, 91, 93], "container": [8, 29], "content": [1, 8, 15, 19, 21, 26, 27, 28, 31, 32, 33, 34, 35, 39, 40, 45, 49, 53, 55, 56, 58, 59, 61, 62, 63, 66, 68, 70, 71, 75, 77, 78, 89, 91], "context": [2, 7, 8, 12, 15, 23, 38, 47, 61, 62, 71], "continu": [8, 10, 19, 21, 24, 25, 26, 27, 30, 33, 34, 35, 40, 47, 49, 54, 55, 56, 58, 59, 60, 62, 63, 66, 70, 74, 78], "contour": [61, 63, 81], "contourf": 81, "contract": 83, "contrast": [2, 87], "contrib": 7, "contribut": [0, 2, 6, 40, 63, 70, 82, 93], "contributor": [6, 8, 25, 59, 63, 88], "control": [12, 14, 37, 45, 61, 63, 81, 86, 87], "control_branch_year": [37, 41], "convect": [40, 87], "convei": [13, 23], "conveni": [8, 69, 72, 81, 93], "convent": [8, 11, 23, 28, 38, 39, 41, 46, 51, 61, 68, 72, 80, 83, 84, 87], "converg": 24, "convers": [6, 11, 24, 61, 63, 65, 80], "convert": [8, 11, 15, 18, 20, 25, 28, 29, 37, 39, 41, 45, 61, 63, 68, 73, 83, 84], "convert_pft_variables_to_spars": 80, "convert_pfts_to_spars": 80, "convex": 67, "convinc": 63, "convolut": [8, 15], "coo": [80, 83], "coo_matrix": 83, "cookbok": 86, "cookbook": [84, 86], "cookiecutt": 4, "cool": [8, 83, 89], "coord": [7, 20, 25, 28, 41, 47, 61, 73, 80, 83, 84, 87], "coordin": [2, 6, 7, 8, 11, 23, 24, 25, 28, 38, 39, 41, 43, 46, 47, 51, 61, 63, 65, 67, 68, 70, 72, 73, 80, 81, 84, 86, 87], "cope": 63, "copi": [6, 7, 12, 21, 53, 57, 58, 59, 65, 66, 71, 72, 80, 83, 86, 87], "cora": 92, "core": [7, 8, 17, 20, 22, 23, 25, 37, 39, 41, 42, 43, 46, 47, 52, 67, 72, 73, 80, 84, 86, 87, 88, 92], "corioli": [67, 86], "corn_lat": 61, "corn_lon": 61, "corner": [0, 50, 57, 59, 61, 67, 68, 86], "corner_lon": 67, "cornersr_x": 67, "cornersstagg": 67, "cornerston": 2, "correct": [11, 47, 63, 68, 74, 75, 80], "correct_plot": 68, "correctli": [7, 8, 30, 43, 49, 50, 55, 67, 87], "correspond": [17, 39, 42, 46, 61, 67, 68, 71, 80], "corrupt": 43, "cos_rot": 86, "cosalpha": 67, "cosalpha_u": 67, "cosalpha_v": 67, "cosin": [67, 86], "cosp": 72, "cosp_ht": 72, "cosp_ht_bnd": 72, "cosp_ht_bndsarrai": 72, "cosp_htpandasindexpandasindex": 72, "cosp_pr": 72, "cosp_prs_bnd": 72, "cosp_prs_bndsarrai": 72, "cosp_prspandasindexpandasindex": 72, "cosp_scol": 72, "cosp_scolpandasindexpandasindex": 72, "cosp_sr": 72, "cosp_sr_bnd": 72, "cosp_sr_bndsarrai": 72, "cosp_srpandasindexpandasindex": 72, "cosp_sza": 72, "cosp_szapandasindexpandasindex": 72, "cosp_tau": 72, "cosp_tau_bnd": 72, "cosp_tau_bndsarrai": 72, "cosp_taupandasindexpandasindex": 72, "cote": 92, "cotton": 80, "could": [8, 10, 12, 13, 15, 20, 25, 28, 29, 38, 41, 45, 46, 47, 52, 61, 62, 67, 68, 69, 72, 73, 75, 79, 80, 83, 86, 87, 90], "couldn": [10, 11], "count": [12, 17, 36, 38, 39, 41, 46, 50, 61, 67, 68, 73, 80], "coupl": [8, 10, 28, 30, 38, 39, 50, 63, 67], "coupler": 61, "cours": [15, 32, 62, 74], "cover": [8, 12, 14, 16, 29, 34, 44, 47, 50, 52, 59, 61, 62, 63, 67, 68, 69, 76, 77, 81, 82, 85, 88], "cowork": [8, 11], "cpl": [28, 61], "cpl6": 61, "cpres0": 65, "cpu": [23, 28, 46, 47, 51, 67, 68, 83, 84, 86], "cr": [23, 41, 43, 61, 80, 81], "craft": 15, "craker": [2, 32, 76, 77], "crawl": 28, "cre": 41, "creat": [0, 1, 4, 6, 8, 12, 13, 14, 15, 16, 18, 19, 20, 21, 23, 24, 26, 27, 28, 31, 32, 33, 34, 35, 37, 40, 41, 43, 44, 45, 46, 48, 49, 51, 52, 53, 54, 55, 56, 58, 61, 63, 66, 67, 68, 69, 70, 71, 72, 73, 78, 80, 81, 82, 91], "create_cmap": 61, "create_dashboard": 18, "create_filepath": 17, "creation": 23, "creator": 64, "creatur": 74, "credit": [8, 63, 64], "creep": [8, 47, 74], "criterion": 47, "critic": [2, 8, 17, 25, 41], "crop": 80, "cropscap": 63, "croptyp": 63, "cross": [7, 8, 24, 63, 90], "crsunit": 61, "cru": 46, "cseg": [61, 80, 90], "csg": 6, "csm": [72, 83], "csmdomain_a": [72, 83], "csv": [20, 28, 41, 44, 46, 63], "csv_kwarg": [20, 28, 39, 41, 61], "ctrl": [12, 36, 45], "ctsm": 24, "cu": [63, 68, 86], "cube": 72, "culmin": [2, 77], "cultur": 2, "cupi": [25, 80], "cupid": 92, "curat": [25, 44], "curios": [24, 44], "curiou": [8, 50, 88], "curious": 10, "curl": [8, 12], "currenc": 2, "current": [4, 6, 8, 10, 12, 15, 24, 25, 28, 38, 39, 46, 47, 59, 61, 68, 72, 80, 83, 84, 93], "curriculum": 63, "curv": 29, "curveplot00876": 84, "curveplot00983": 84, "curvilinear": 72, "custom": [80, 88], "custom_plot": 81, "customari": 65, "cut": 41, "cutoff": 46, "cv": 86, "cvdp": 24, "cvmix": 86, "cvs_revis": [72, 83], "cyclic": 74, "cyclon": [90, 92], "d": [0, 6, 7, 8, 11, 15, 17, 20, 23, 24, 37, 38, 39, 41, 43, 45, 46, 47, 51, 61, 63, 65, 67, 68, 79, 81, 84, 86, 87, 90], "d1280585": 67, "d2": 68, "d67h1h0v": [28, 39, 61, 68, 84, 87], "d67h1h0vcell_method": 39, "d67h1h0vconvent": 61, "d67h1h0vrevis": 68, "d67h1h0vsourc": 84, "d67h1h0vtime_period_freq": [84, 87], "d92edee1": 61, "da": [11, 37, 39, 41, 46, 73, 80, 83], "da6eb586": 73, "dagon": [2, 76, 77], "dai": [8, 10, 11, 25, 28, 38, 39, 42, 46, 61, 62, 63, 67, 68, 72, 75, 76, 77, 80, 81, 83, 84, 86, 88, 90, 92], "daili": [4, 8, 28, 36, 37, 65, 68, 81, 84, 86, 87], "dailyoutput_mod": 17, "damien": 25, "damon": [8, 90], "dan": 92, "danger": 29, "daniel": [2, 92], "darkblu": 65, "dashboard": [7, 8, 17, 20, 22, 37, 38, 39, 41, 43, 46, 47, 52, 61, 63, 67, 68, 73, 83, 84, 86, 87], "dask": [6, 8, 10, 24, 28, 41, 44, 46, 47, 61, 63, 67, 68, 71, 72, 83, 84, 85, 86, 92], "dask_gufunc_kwarg": [61, 80], "dask_jobqueu": [8, 22, 38, 43, 46, 61, 68, 83, 84, 87], "dasker": 25, "dasky_arrai": 80, "data": [2, 3, 6, 10, 11, 12, 13, 15, 16, 17, 20, 24, 25, 36, 40, 42, 44, 48, 50, 51, 53, 59, 60, 64, 69, 71, 73, 78, 80, 82, 84, 88, 90, 92, 93], "data_catalog": [38, 61], "data_catalog_subset": 61, "data_fil": [72, 83], "data_format": [20, 28, 41], "data_in": 72, "data_out": 83, "data_path": 83, "data_process": 83, "data_var": [7, 43, 61, 84, 87], "dataarrai": [7, 11, 39, 41, 46, 47, 61, 65, 67, 68, 72, 73, 81, 83, 87], "dataarrayi": 80, "dataarraylat": 83, "dataarraylon": 83, "dataarraymember_id": 68, "dataarrayocean_tim": 73, "dataarrayseason": 81, "dataarraytim": [65, 80], "dataarrayvegtyp": 80, "dataarrayx": 80, "databas": [8, 43, 61], "datafil": [12, 13], "datafram": [18, 20, 23, 28, 36, 41, 42, 50, 59, 62], "datarefer": 61, "datarrai": 61, "dataset": [2, 6, 7, 8, 10, 11, 20, 25, 28, 29, 30, 31, 36, 38, 42, 51, 61, 62, 63, 65, 68, 71, 72, 73, 80, 81, 83, 84, 92, 93], "dataset_titl": 46, "datasetdimens": [17, 23, 38, 39, 41, 46, 61, 65, 67, 68, 72, 73, 80, 83, 84, 86, 87], "datasetset": 41, "datasetview": 86, "datashad": [8, 32, 39, 83], "datastor": [37, 41, 42], "datatreegroup": 86, "date": [0, 8, 11, 15, 18, 20, 28, 30, 39, 41, 42, 61, 72, 80, 83, 84], "date_cr": 61, "date_modifi": 61, "date_written": [28, 72, 80, 83, 84], "datepalm": 80, "datesec": [28, 72, 83, 84], "datetim": [11, 15, 41, 46, 61, 73, 81, 84], "datetime64": [46, 65, 67, 81], "datetimeindex": [11, 65, 81], "datetimenoleap": [7, 17, 23, 38, 46, 68, 72, 80, 83, 84, 86, 87], "dateunit": 80, "daunt": 67, "dav": [22, 37, 41, 43, 52, 87], "dave": 92, "davi": 25, "david": 32, "day_1": [20, 84, 87], "day_1histori": 87, "day_1topography_fil": 84, "day_1xarrai": 84, "daylight": [8, 26, 27, 33, 34, 66], "dayofyear": 11, "days_in_month": 68, "dcherian": [25, 73, 80, 84, 86, 87], "dcpy": 80, "dd": 11, "de": [29, 87], "deactiv": 7, "deadtim": 63, "deal": [8, 11, 16, 23, 25, 28, 35, 37, 43, 51, 63, 82], "dear": 15, "debug": [8, 28, 32, 62, 81, 90], "dec": 17, "decad": [31, 61], "decav": 61, "decemb": [7, 8, 40, 65, 68, 81], "decid": [8, 15, 16, 74], "decis": [29, 87], "declar": [13, 15], "declin": 32, "decod": [11, 80, 86], "decode_cf": 11, "decode_tim": [41, 43, 61, 80], "decor": 38, "decreas": 47, "dedic": [8, 10, 24, 25], "deep": [62, 63, 67, 86], "deepak": [2, 8, 17, 25, 32, 70, 76, 77, 89, 90], "deepcopi": 86, "deeper": [2, 8, 62, 75, 76, 88], "deepest": 47, "def": [11, 17, 20, 23, 37, 38, 39, 41, 43, 44, 46, 47, 51, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "default": [12, 14, 15, 28, 29, 39, 45, 52, 62, 68, 72, 80, 86, 87, 88], "default_cache_typ": 84, "default_fill_cach": 84, "defici": 2, "defin": [12, 13, 14, 15, 24, 38, 47, 61, 62, 63, 65, 69, 86], "definit": [14, 38, 62, 69], "deg": 73, "deg_coord": 73, "degc": [36, 37, 61, 65, 68, 81, 86], "degcgrid_loc": [39, 61], "degclong_nam": 46, "degcprecis": 81, "degcxarrai": 68, "degf": 65, "degre": [8, 18, 37, 38, 61, 63, 65, 67, 72, 73, 81, 83], "degree_dim": 73, "degrees_celsiu": 61, "degrees_celsiusxarrai": 61, "degrees_east": [23, 61, 72, 80, 83, 84, 86], "degrees_eastactual_rang": 46, "degrees_eastarrai": [38, 39, 41, 46, 61, 80, 84, 86], "degrees_eastaxi": [61, 87], "degrees_eastbound": [17, 84], "degrees_eastgeospatial_lon_resolut": 61, "degrees_eastlong_nam": [41, 81], "degrees_eastvalid_rang": 41, "degrees_north": [23, 61, 72, 80, 83, 86], "degrees_northactual_rang": 46, "degrees_northarrai": [38, 39, 41, 46, 61, 80, 84, 86], "degrees_northaxi": [61, 87], "degrees_northbound": 17, "degrees_northgeospatial_lat_resolut": 61, "degrees_northlong_nam": [41, 81], "degrees_northvalid_rang": 41, "degreesarrai": 72, "degreesgeospatial_lon_unit": 61, "degreesgeospatial_vertical_unit": 61, "degreesummari": 61, "delai": [25, 84, 86], "delaunai": 23, "delavan": 40, "deleg": 2, "delet": [12, 17, 30, 35, 43], "deliv": 2, "deliveri": 6, "delta": 81, "delta_t": 81, "demand": 88, "demo": [6, 35], "demonstr": [8, 11, 44, 46, 71, 72, 83, 84], "denni": 72, "denomin": 68, "dens": [8, 80], "densifi": 80, "densiti": [25, 47], "depart": [8, 90], "depend": [6, 11, 29, 38, 43, 44, 47, 52, 62, 63, 87], "dependent_vari": 38, "deploi": [18, 25, 44, 63], "deploy": [2, 91], "deprec": [68, 87], "depriv": [8, 15], "depth": [8, 20, 28, 39, 41, 50, 61, 67, 68, 73, 86], "depth_bnd": 61, "depth_bndsposit": 61, "depthbound": 61, "deptho": 86, "depthstagg": 67, "depthstandard_nam": 86, "depthunit": 72, "derecho": [4, 7], "deriv": [8, 31, 44, 53, 67], "derived_vari": 38, "derivedvari": 38, "derivedvariableregistri": 38, "describ": [2, 8, 28, 37, 46, 50, 59, 61, 73, 80, 86], "descript": [0, 6, 37, 50, 67, 69, 86, 88, 90], "deserv": [8, 64], "design": [6, 8, 10, 15, 16, 23, 25, 47, 56, 70, 75, 78, 82], "desir": [6, 13, 44, 48, 52, 59], "despit": [2, 8, 74], "destarea": [72, 83], "destareamap_method": [72, 83], "destin": 61, "detail": [4, 7, 8, 10, 11, 28, 29, 32, 35, 37, 39, 50, 52, 57, 64, 81, 84, 85, 86, 88, 91], "detect": [12, 73, 80], "determ": 61, "determin": [8, 12, 14, 28, 45, 47, 59, 65, 68], "detrend": [8, 67], "detrend_dim": 73, "dev": [7, 25, 38, 41, 61, 63, 67, 68, 83], "dev056revision_id": 80, "develop": [2, 4, 8, 10, 20, 25, 29, 31, 33, 34, 50, 56, 57, 59, 60, 61, 64, 67, 74, 78, 80, 83, 84, 88, 90, 92, 93], "deviat": [61, 67, 81], "devlop": 25, "dewpoint": 65, "dewpoint_plot": 65, "df": [18, 20, 28, 36, 37, 39, 41, 42, 43, 46, 50], "df_histori": 20, "df_list": 18, "df_timeseri": 20, "di": 62, "diagnos": 47, "diagnost": [4, 8, 18, 25, 28, 31, 32, 38, 41, 61, 63, 68, 86], "diagnot": 32, "diagraph": 50, "dialog": 7, "diatc": 43, "diatchl": 43, "diaz_nfix": 44, "dic": 44, "dict": [17, 41, 44, 47, 80, 83, 84, 86], "dict_kei": [37, 39, 41, 46, 61, 86], "dictionari": [8, 13, 15, 16, 18, 28, 37, 38, 41, 42, 43, 44, 46, 47, 61, 82], "did": [11, 12, 19, 21, 26, 27, 41, 49, 54, 55, 84, 90], "didn": [8, 15, 46, 51, 63, 72, 74, 83, 87, 90], "die": 25, "diff": [39, 46, 81], "diff_perc": 39, "differ": [2, 4, 7, 8, 11, 12, 14, 15, 16, 18, 24, 25, 28, 31, 36, 39, 41, 44, 45, 50, 53, 61, 62, 63, 65, 69, 71, 74, 80, 82, 83, 86, 87, 88, 89, 90], "difference_plot": [39, 68], "difference_plot_perc": 39, "difficult": [8, 11, 23, 28, 42, 50, 61, 62, 63, 64, 67, 71], "difficulti": [59, 79], "diffus": 86, "dig": [8, 43, 68], "digit": [63, 64], "digraph": [36, 50], "dim": [17, 20, 28, 31, 39, 41, 43, 46, 47, 51, 61, 68, 72, 73, 80, 83, 87], "dim_avg_n": 41, "dimens": [7, 8, 11, 17, 23, 28, 31, 38, 39, 41, 46, 47, 51, 61, 65, 67, 68, 70, 72, 73, 81, 84, 86, 87], "dimension": [8, 47, 70, 80], "dimension0003": 67, "dimension0012": 67, "dimension0016": 67, "dimension0021": 67, "dimension0132": 67, "dimensionlessdescript": 67, "dimlst": 83, "dims_in": [47, 72], "dir": [37, 41, 67], "direct": [6, 8, 24, 36, 49, 61, 63, 67], "directionstagg": 67, "directli": [6, 8, 12, 18, 20, 23, 31, 39, 43, 50, 67, 80], "directori": [8, 18, 19, 21, 22, 26, 27, 37, 39, 40, 41, 43, 44, 45, 52, 55, 56, 57, 58, 65, 66, 69, 70, 73, 78, 84, 86, 87], "directorystor": 86, "disabl": 45, "disc": [45, 86], "discard": 13, "disciplin": [2, 62, 63], "disciplinari": 2, "disconnect": 29, "discourag": [8, 74], "discours": [2, 7, 44], "discoveri": 31, "discrep": 81, "discret": 64, "discrete_slid": 18, "discuss": [6, 7, 8, 29, 39, 59, 76, 77, 81, 83, 85, 86, 90], "dishearten": [8, 74], "disk": [17, 20, 37, 61, 62, 73, 80, 84, 86], "dispatch": 83, "displai": [12, 15, 20, 72, 73, 80, 83], "disrupt": 2, "distinct": 11, "distribut": [7, 8, 17, 20, 22, 32, 37, 38, 39, 41, 43, 46, 52, 61, 63, 67, 68, 73, 84, 86, 87], "distributiontime_coverage_start": 61, "div": 18, "dive": [59, 62, 63, 75, 76], "divers": [2, 8, 63, 88], "divid": 46, "divis": 14, "django": [8, 15], "djf": [41, 81], "dll": 80, "dllversion": 80, "do": [0, 1, 6, 8, 10, 11, 12, 13, 14, 15, 19, 20, 21, 23, 25, 26, 27, 30, 31, 33, 34, 35, 38, 39, 44, 45, 46, 48, 49, 50, 53, 54, 55, 56, 57, 58, 60, 61, 62, 63, 65, 66, 68, 69, 70, 71, 72, 73, 74, 75, 77, 78, 80, 81, 82, 83, 86, 87, 88, 89, 90], "doc": [7, 8, 29, 30, 44, 62, 68, 73, 75, 76, 86, 87], "docr": 44, "docstr": 17, "document": [2, 4, 6, 7, 8, 11, 15, 17, 24, 25, 28, 29, 31, 37, 42, 44, 48, 51, 53, 57, 61, 62, 63, 64, 65, 67, 70, 71, 78, 83], "dods_extra": 46, "dodsc": 46, "doe": [10, 11, 12, 13, 14, 15, 20, 29, 44, 45, 46, 47, 48, 50, 61, 69, 73, 83, 84, 86, 87, 90], "doesn": [8, 12, 29, 38, 45, 73, 81, 83, 87, 88], "doi": [8, 28, 29, 39, 46, 61, 68, 84, 87], "dokku": 18, "domain": [8, 23, 25, 47], "domain_a": [72, 83], "domain_b": [72, 83], "domin": 67, "don": [7, 12, 14, 15, 25, 29, 45, 63, 69, 74, 88, 89], "done": [8, 11, 12, 20, 21, 23, 24, 28, 29, 46, 47, 50, 58, 66, 69, 71, 87, 88], "doppler": 63, "dot": [8, 36, 48, 50, 72, 83], "doubl": [23, 28, 45, 50, 57, 71, 88], "doubletime_rep": 17, "down": [7, 8, 24, 25, 28, 45, 47, 59, 61, 74, 77, 88], "downcreator_nam": 61, "download": [8, 12, 24, 40, 45, 56, 59, 61, 65, 66, 70, 78], "downsid": 86, "downstandard_nam": [38, 41, 46, 72, 83, 84], "downunit": [61, 68, 86], "downvalid_min": [39, 61], "downvot": 74, "dp": 65, "dpi": [48, 80], "dr": [8, 56, 85, 91], "draft": 17, "draw": [76, 81], "drawback": 71, "dream": 10, "drew": [2, 8, 32, 58, 78, 89, 92], "drive": [2, 15], "driven": [6, 8, 10, 24, 44], "driver": 24, "drop": [7, 18, 30, 43, 46, 47, 57, 61, 65, 83, 86], "drop_dim": 83, "drop_tim": 86, "drop_var": [72, 83], "dropna": 46, "ds277": 81, "ds_ann": 43, "ds_first_five_year": 68, "ds_in": [61, 72], "ds_list": 39, "ds_out": [43, 61, 72], "ds_read_directli": 84, "ds_standard_unit": 65, "ds_to_plot": 67, "ds_whole": 47, "dset": [20, 28, 37, 38, 39, 41, 42, 43, 46, 61], "dset_dict": 42, "dset_dict_so": 42, "dset_dict_thetao": 42, "dset_list": 61, "dsets2": 43, "dsigma": 47, "dso": 83, "dst": 83, "dst_grid_dim": [72, 83], "dst_grid_rank": [72, 83], "dstlat": 83, "dstlon": 83, "dsw": 83, "dt": 68, "dtype": [7, 11, 17, 18, 23, 37, 38, 39, 41, 46, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "dtypewarn": [37, 41], "du": 23, "dual": [8, 15, 57, 88, 90], "duck": [25, 74], "duck_array_op": 83, "due": [8, 13, 29, 67, 83], "dummi": [72, 83], "dummy_in": [72, 83], "dummy_out": [72, 83], "dump": [63, 84, 86], "duplic": [29, 45, 63], "durat": 15, "dure": [6, 8, 12, 13, 14, 16, 23, 24, 28, 30, 31, 40, 45, 48, 53, 61, 62, 64, 76, 77, 78, 79], "dvr": 38, "dynam": [40, 72], "dz": 43, "dzlake": 80, "dzsoi": 80, "e": [0, 6, 8, 10, 13, 14, 15, 23, 28, 38, 43, 45, 49, 51, 54, 61, 67, 71, 72, 80, 81, 86, 87, 90], "e11": [7, 38], "e1214b55": 84, "e13": [72, 83], "e20": [28, 61], "e21": [84, 87], "e22": [18, 20], "e23": 86, "e3a9b95111fb": 87, "e3sm": 24, "e503263520abd161067be1f5e311c2e1gpp": 80, "e622b658eb45": 84, "each": [2, 6, 7, 8, 11, 12, 13, 15, 16, 17, 24, 28, 29, 36, 37, 39, 40, 46, 47, 50, 53, 59, 61, 62, 63, 64, 65, 67, 68, 69, 71, 75, 76, 77, 80, 81, 83, 86, 87, 90], "eager": 74, "earli": [8, 11, 32, 90], "earlier": 23, "earth": [2, 3, 6, 20, 24, 28, 29, 30, 31, 36, 37, 40, 41, 46, 56, 59, 63, 88, 92], "earthcub": [24, 59], "eas": [28, 46], "easi": [8, 15, 23, 24, 25, 29, 61, 71, 72, 73, 74, 81, 86], "easier": [6, 8, 12, 16, 23, 24, 25, 39, 46, 50, 51, 52, 57, 61, 63, 67, 68, 74, 78, 81], "easiest": [15, 29, 45, 62], "easili": [2, 8, 15, 17, 23, 28, 29, 41, 47, 52, 71, 80], "east": 41, "east_grid_dimens": 67, "east_patch_end_stag": 67, "east_patch_end_unstag": 67, "east_patch_start_stag": 67, "east_patch_start_unstag": 67, "eastern": 81, "eaton": [28, 39, 61, 68], "ebaf": 41, "ebaf_01_climo": 41, "ebb8a0fc": 86, "ecgtool": [8, 32, 39, 50], "ecmwf_09_climo": 41, "ecocystem": 44, "econom": 63, "ecosi": 18, "ecosystem": [8, 24, 25, 29, 30, 31, 32, 39, 43, 50, 59, 61, 62, 63, 67, 70, 72, 89], "ecoysystem": 44, "ed": 61, "edg": [36, 50], "edgecolor": 81, "edif": 15, "edit": [0, 8, 18, 45, 52, 66, 69, 88], "editor": [12, 57, 69], "edu": [8, 12, 18, 19, 21, 22, 26, 27, 28, 33, 34, 35, 37, 38, 39, 40, 41, 43, 46, 49, 52, 54, 55, 56, 57, 58, 60, 61, 62, 66, 67, 68, 70, 75, 78, 82, 83, 84, 86, 87, 88], "educ": [8, 16, 32, 59, 74, 78], "edwardsj": 72, "effect": [2, 6, 8, 10, 16, 23, 30, 31, 41, 45, 59, 61, 67, 73, 84], "effici": [2, 8, 29, 31, 68, 86, 88], "effient": [8, 70], "effort": [2, 6, 8, 24, 25, 29, 44, 63, 64, 80], "eg": 85, "egistri": 38, "einsum": 83, "either": [14, 23, 35, 44, 50, 68], "elaps": [20, 28], "element": [8, 13, 15, 53, 63, 72, 80, 83, 90], "elena": [76, 77, 89], "elif": [41, 80], "elimin": 63, "els": [13, 17, 25, 41, 47, 57, 74, 80, 81, 86], "elsewher": [7, 86], "email": [7, 8, 12, 15, 85, 88, 91], "embarassingli": [8, 47], "embed": [40, 62], "embrac": 2, "emc2": 63, "emerg": [2, 6], "emm": 92, "emma": 89, "empathet": [8, 74], "emphasi": 24, "employe": [25, 63], "empow": [25, 91], "empti": [13, 15, 18, 46, 63, 69, 72, 80, 83, 86], "enabl": [2, 8, 20, 25, 29, 31, 37, 38, 39, 43, 59, 61, 71, 84, 88, 93], "encapsul": 2, "enclos": 15, "encod": [7, 11, 43, 80, 84, 86, 87], "encount": [8, 11], "encourag": [2, 8, 23, 30, 44, 59, 77, 85, 90, 92], "end": [0, 7, 8, 12, 13, 14, 17, 20, 24, 25, 42, 48, 50, 61, 62, 65, 67, 72, 73, 81, 86, 87, 90], "end_tim": [20, 36, 37, 38, 46, 61], "endblock": 15, "endif": 15, "endpoint": [38, 72, 80, 83, 84], "endpointsarrai": 23, "energi": [8, 41, 90], "engag": [2, 59, 63], "engin": [2, 4, 8, 10, 15, 17, 29, 40, 56, 63, 65, 67, 79, 82, 84, 86], "enhanc": [6, 8, 88], "enjoi": [40, 90], "enorm": [8, 10], "enough": [7, 31, 62, 63, 81, 90], "ensembl": [8, 31, 36, 37, 38, 41, 43, 47, 68, 84, 87], "ensur": [8, 23, 24, 25, 29, 39, 43, 50, 57, 66, 71], "enter": [52, 57, 71], "enterpris": 92, "enthought": 63, "entir": [8, 12, 15, 20, 23, 25, 42, 45, 46, 61, 73], "entrain": [2, 25, 59], "entri": [2, 80, 86], "env": [1, 7, 15, 19, 21, 26, 27, 28, 33, 34, 37, 38, 40, 41, 45, 55, 58, 61, 66, 67, 68, 70, 71, 78, 80, 84, 87], "env_extra": 84, "env_nam": 12, "enviro": 71, "environ": [1, 2, 12, 15, 19, 21, 25, 26, 27, 28, 29, 30, 33, 34, 40, 45, 49, 50, 54, 55, 56, 58, 66, 67, 69, 70, 78, 83, 85, 88], "environment": 61, "envnam": 49, "eo": 47, "eof": [7, 48], "eol": 2, "ep": [41, 48], "epsg": 61, "equal": [7, 28, 41, 61, 67, 68, 81, 87], "equiangular": 72, "equip": [6, 29], "equitori": 81, "equival": [13, 53, 67, 84], "erai_04_climo": 41, "erai_djf_climo": 41, "erbe_07_climo": 41, "eriv": 38, "erod": 67, "erodstagg": 67, "eroglu": [2, 30, 32, 76, 77, 92], "error": [6, 7, 8, 11, 12, 23, 43, 45, 46, 47, 60, 61, 68, 73, 80, 81, 83, 84], "ers_12_climo": 41, "esd": [4, 7, 24, 28, 39, 50, 64, 68, 73, 79, 83, 90, 91, 93], "esm": [8, 30, 31, 32, 44, 61, 86], "esmf": [8, 72, 83], "esmf_regrid_method": [72, 83], "esmf_regridweightgen": 83, "esmlab": 43, "esmpi": 83, "esp": [28, 31], "especi": [7, 8, 25, 28, 29, 36, 62, 64, 65, 67, 74], "espwg": 20, "esrl": 46, "essenti": [2, 7, 8, 11, 14, 15, 23, 25, 31, 39, 60, 62, 75, 80, 86], "establish": 63, "estim": 59, "et": [8, 17, 31, 37, 72], "eta_rho": 73, "etc": [6, 7, 8, 10, 13, 20, 28, 29, 38, 44, 63, 69], "europ": 63, "evalu": [15, 24, 38, 40, 64, 73, 93], "even": [6, 8, 12, 15, 25, 28, 29, 41, 42, 61, 63, 64, 69, 74, 84, 86, 87, 88], "event": [6, 8, 16, 19, 21, 26, 27, 32, 33, 34, 35, 49, 54, 55, 56, 58, 60, 63, 66, 70, 75, 77, 78, 82, 88, 90, 91], "eventu": [8, 74, 79], "ever": [69, 88], "everi": [6, 8, 11, 12, 13, 14, 15, 24, 28, 42, 44, 45, 63, 65, 79, 80, 81, 82, 83, 86, 87], "everyon": [76, 92], "everyth": [13, 14, 15, 25, 36, 47, 57, 73], "evolut": [29, 63], "evolv": [61, 63, 64], "ex": [7, 8, 24, 25, 28, 29, 31, 36, 37, 41, 43, 44, 59, 62, 63, 64, 67, 68, 84], "exactli": [15, 28, 39, 61, 68], "examin": [8, 23, 32, 36, 44, 73, 80], "exampl": [4, 6, 7, 8, 10, 11, 12, 13, 14, 15, 20, 24, 25, 28, 29, 31, 38, 39, 41, 44, 46, 47, 48, 50, 51, 52, 59, 61, 62, 63, 64, 65, 67, 68, 71, 74, 80, 81, 82, 83, 84, 87, 88, 90], "exce": [47, 63], "except": [15, 17, 41, 67, 83], "exchang": [6, 90], "excit": [8, 20, 38, 39], "exclud": [13, 28, 63, 80], "exclude_dim": 80, "exclude_pattern": [20, 28], "exclus": 13, "exec": [37, 41, 84], "execcasp": [22, 43, 52, 87], "execut": [2, 14, 28, 41, 44, 45, 50, 56, 59, 69, 75, 84], "execute_notebook": [44, 50, 71], "exemplifi": [8, 10], "exercis": 38, "exhaust": 74, "exist": [0, 2, 7, 8, 10, 13, 14, 15, 29, 32, 37, 38, 48, 69, 80, 83, 84, 86, 87], "exist_ok": 86, "exit": [12, 45], "exp": 43, "exp_i": 36, "expand": [44, 80, 83, 87, 88], "expand_dim": [72, 83, 87], "expandus": 87, "expans": 87, "expect": [8, 17, 43, 45, 47, 51, 72, 73, 74, 80, 83, 87, 88, 90], "expens": [20, 43, 61, 73, 87], "experi": [4, 6, 8, 15, 16, 29, 36, 37, 38, 42, 43, 46, 50, 59, 62, 74, 82, 84, 87, 88, 90], "experiment": [10, 56, 67], "experiment_id": [37, 42], "expert": [8, 15, 62, 88, 90], "expertis": [2, 24, 29, 90], "explain": [7, 8, 12, 13, 15, 16, 81], "explan": [8, 15, 23], "explicit": [23, 25, 29, 87], "explicitli": [2, 14, 15, 84], "explor": [8, 23, 25, 29, 44, 46, 61, 63, 71, 73, 80, 83, 88, 91], "exploratori": 44, "export": [23, 45, 46, 51], "express": [10, 15, 23, 28, 87], "ext": 48, "extend": [15, 30, 31, 71, 81, 84], "extens": [2, 15, 18, 20, 23, 28, 30, 31, 32, 38, 39, 41, 42, 46, 51, 57, 61, 65, 67, 68, 84, 93], "extenst": 65, "extern": [8, 59, 69, 82], "extra": [8, 12, 13, 52, 74, 80, 84], "extract": [2, 23, 39, 63, 68, 80, 86, 87, 90, 92], "extran": 15, "extrem": [10, 15, 63, 67, 90], "ey": [7, 74, 78, 80], "f": [1, 7, 8, 14, 17, 18, 19, 20, 21, 26, 27, 33, 34, 39, 41, 44, 47, 50, 55, 58, 61, 67, 71, 72, 80, 83, 84, 86, 88], "f02n07": 38, "f02n07important_not": 38, "f09_g16": [7, 38], "f09_g17": [84, 87], "f11": [72, 83, 84], "f11vmr": [72, 83, 84], "f12": [72, 83, 84], "f12vmr": [72, 83, 84], "f19_g1": 39, "f19_g17": [28, 39, 44], "f368": 61, "f4": 86, "f43c56e0": 86, "f59b0bfe": 84, "f59e9f61": 87, "f6f0": 37, "f6zb330g": 41, "f8": 86, "f90": [61, 80], "face": [8, 29, 36, 74, 88, 90], "facelift": [8, 10], "facil": [6, 8, 10], "facilit": [90, 93], "fact": [12, 15, 39, 88], "factor": [7, 29], "faculti": 63, "fahrenheit": 38, "fail": [7, 12, 14, 25, 42, 69, 80, 84], "fairli": [8, 50, 72, 88], "fake": [72, 80], "falko": [2, 92], "fall": [8, 10, 16, 77, 84], "fals": [11, 15, 18, 20, 37, 41, 42, 43, 45, 46, 47, 61, 67, 73, 80, 81, 84, 86], "famili": 23, "familiar": 35, "fan": 40, "fanast": 62, "fantast": 62, "faq": [8, 28, 29, 30, 37], "far": [8, 32, 59, 63, 68, 74], "fast": [25, 32, 84, 86], "faster": [20, 29, 53, 74, 80], "fastest": 29, "fatal": 12, "fault": 67, "favorit": 63, "featur": [8, 23, 38, 41, 63, 71, 74, 80, 81], "feature_artist": 80, "featureartist": 80, "feb": 41, "februari": [7, 8, 11, 16, 60, 61, 68, 78, 81], "fed": [20, 28, 41], "feder": 63, "feed": [63, 71], "feedback": [6, 17, 24, 77, 83, 90], "feel": [4, 6, 8, 12, 15, 23, 29, 35, 74, 75, 88], "fellow": 32, "felt": 11, "few": [6, 7, 8, 22, 23, 25, 28, 37, 39, 41, 43, 44, 51, 57, 59, 61, 62, 63, 65, 67, 71, 73, 80, 84, 86, 90], "fewer": [45, 80], "ff": 7, "ff91a4a71464": 61, "ffbb27b2e849e89719a8455875172787": 73, "fg": 80, "fg_co2": [20, 44], "field": [7, 8, 24, 32, 38, 39, 42, 43, 61, 63, 67, 83, 86], "field_target": 83, "fieldtyp": 67, "fifth": [8, 69], "fig": 37, "figsiz": [37, 47, 81], "figur": [8, 11, 28, 31, 36, 37, 46, 47, 48, 63, 65, 72, 80, 81], "figurenam": 48, "file": [0, 1, 8, 12, 13, 14, 15, 16, 19, 21, 26, 27, 29, 30, 31, 32, 37, 39, 40, 42, 43, 45, 46, 48, 52, 55, 56, 58, 61, 63, 65, 66, 69, 70, 78, 80, 82, 90, 93], "file_access": 20, "file_read_in": 20, "file_subset": 67, "filelist": 84, "filenam": [7, 12, 17, 20, 48, 50, 72, 83], "filename_1980": 17, "filename_1981": 17, "filename_1982": 17, "filepath": [18, 20, 28, 41], "fileserv": 61, "filesystem": [8, 12, 20, 39, 41, 61, 84], "filesystemload": 15, "fill": [6, 15, 16, 41, 63, 80, 81, 90], "fill_valu": [47, 80, 83, 86], "filter": 86, "filterwarn": [20, 43, 46], "final": [7, 8, 23, 46, 66, 76, 80], "find": [6, 8, 11, 15, 24, 25, 32, 34, 37, 57, 59, 67, 73, 79, 81, 82, 86, 87, 88, 89, 92], "fine": [14, 45, 90], "finer": [8, 23, 81], "finidat_interp_dest": 80, "finish": [8, 14, 20, 28, 50], "first": [0, 7, 8, 11, 12, 13, 14, 15, 16, 18, 19, 21, 23, 26, 27, 28, 31, 32, 33, 34, 35, 36, 38, 39, 40, 41, 43, 44, 49, 50, 54, 55, 58, 60, 61, 62, 63, 65, 66, 68, 70, 72, 73, 74, 76, 78, 80, 81, 82, 84, 86, 88, 90], "first_cas": 39, "first_plot": 39, "fish": 12, "fit": [7, 8, 20, 62, 73, 87], "fitzgerald": [2, 92], "five": [18, 24, 68], "fix": [0, 7, 17, 39, 45, 80, 86, 88], "fix_tim": 65, "flag": [7, 67], "flag_canfra": 67, "flag_clayfrac": 67, "flag_erod": 67, "flag_frc_urb2d": 67, "flag_imperv": 67, "flag_mean": 80, "flag_sandfrac": 67, "flagdescript": 67, "flagstagg": 67, "flask": [8, 15], "flat": [68, 80], "flatlin": 62, "flexibl": [7, 23, 24, 25, 51, 63, 86, 93], "flexibli": 23, "flip": [75, 76, 77], "flist": [84, 86], "fln": 36, "flnsc": 36, "float": [11, 13, 14, 15, 47, 48, 61, 73, 80, 87], "float32": [11, 23, 28, 38, 39, 41, 46, 51, 61, 65, 67, 68, 72, 80, 81, 83, 86, 87], "float320": [41, 61, 65, 80], "float321": [41, 65], "float3213": 65, "float32180": 81, "float3219": 81, "float322": 46, "float32260": 65, "float3227": 65, "float32372": 61, "float3239": 65, "float32500": [39, 61, 68], "float327": 65, "float32804": 65, "float3287": 46, "float32dask": [38, 39, 46, 61, 67, 68, 72, 80, 83, 86, 87], "float32nan": 46, "float64": [11, 17, 23, 28, 38, 39, 41, 46, 51, 61, 68, 72, 73, 80, 81, 83, 84, 86, 87], "float640": [38, 41, 46, 61, 72, 80, 83, 84, 86, 87], "float641": [73, 86], "float642": [46, 72, 83, 84, 86], "float64240": 72, "float64244": 83, "float643": [38, 41, 46, 72, 83, 84], "float64320": 39, "float64321": 39, "float64500": 61, "float64900": 72, "float64dask": [17, 46, 61, 72, 73, 80, 83, 84], "float64index": [72, 81, 83, 84, 86], "float64nan": [46, 61], "float64nanlong_nam": 46, "floor": 86, "flow": 67, "flowstagg": 67, "flu": 36, "fluctuat": 63, "flut": [36, 41], "flutc": 41, "flux": [36, 41, 86], "fluxtime_avg_info": 86, "fluxunit": 41, "fname": 84, "fo": [84, 86], "focu": [2, 18, 23, 25, 29, 42, 52], "focus": [2, 6, 8, 24, 25, 29, 32, 40, 44, 46, 63, 92, 93], "foddergrass": 80, "folder": [0, 12, 25, 86], "folk": 90, "follow": [3, 7, 8, 11, 12, 15, 16, 17, 19, 20, 21, 23, 24, 26, 27, 28, 29, 30, 31, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 44, 46, 47, 49, 50, 52, 54, 55, 56, 57, 58, 59, 61, 62, 63, 64, 65, 66, 67, 68, 70, 71, 73, 74, 75, 76, 78, 80, 82, 90, 92], "fontsiz": 37, "foothil": [8, 65], "forc": [8, 10, 14, 24, 37, 44, 72], "forcing_vari": [37, 41, 46], "forecast": [8, 30, 31, 67], "forehead": 15, "forg": [7, 23, 25, 28, 36, 44, 50, 52, 63, 71, 72, 83, 84, 86], "forget": 77, "fork": [0, 35], "form": [2, 8, 11, 15, 16, 29, 59, 63, 70, 77, 80, 85, 86, 87], "formal": [8, 15, 59, 86, 89], "format": [0, 6, 8, 11, 14, 17, 20, 24, 28, 29, 37, 41, 42, 44, 46, 48, 50, 59, 62, 65, 67, 77, 80, 83, 84, 86, 92], "format_exc": 41, "format_funct": 61, "formatcoodata": [80, 83], "fortun": [8, 15, 23, 25, 37, 50, 61, 64, 65], "forum": [7, 8, 76, 77, 92], "forward": [8, 12, 24, 29, 30, 32, 59, 67, 75, 77, 83, 85], "fosi": 20, "foster": [2, 8, 25, 88], "found": [7, 8, 12, 15, 20, 25, 28, 37, 41, 47, 50, 53, 57, 59, 62, 64, 76, 81, 83, 88], "foundat": [4, 15, 31, 63, 65], "four": [61, 62, 63, 90], "fourier": 46, "fourth": [8, 69], "fpar": 67, "fparstagg": 67, "fptr": 44, "fpzptb2f": 37, "frac_a": [72, 83], "frac_b": [72, 83], "fraction": [2, 63, 67, 80], "fractiondescript": 67, "fractionstagg": 67, "frame": [43, 63], "frame_width": 72, "framework": [24, 29, 30, 39, 71], "frc_urb2d": 67, "free": [4, 6, 15, 23, 29, 35, 57, 75, 90], "freedonia": 15, "freq": [46, 65, 72, 81, 83, 84, 86, 87], "freq_i": [36, 50], "frequenc": [8, 20, 28, 36, 37, 38, 39, 41, 42, 46, 61, 68, 81, 86], "frequent": 63, "fridai": [8, 63, 75, 77, 85, 88], "friend": [11, 74, 80], "friendli": [46, 62, 86], "fro": 63, "from": [0, 2, 4, 6, 7, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 25, 26, 27, 29, 30, 31, 32, 33, 34, 35, 36, 38, 40, 42, 43, 44, 45, 47, 48, 49, 51, 52, 53, 54, 55, 56, 57, 58, 59, 62, 63, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 78, 79, 80, 83, 85, 86, 87, 88, 89, 90, 92, 93], "from_arrai": [73, 80], "from_list": 61, "from_sequ": 86, "from_weights_fil": 72, "front": 13, "frontend": [8, 15, 61], "frontera": 72, "frozen": 7, "fruit": 90, "fs_s3": 84, "fsn": 36, "fsnsc": 36, "fsntoa": 41, "fsntoac": 41, "fsspec": [84, 86], "ftp": 65, "full": [25, 30, 46, 47, 48, 62, 63, 67, 86, 92], "full_lik": [47, 83], "fulli": [8, 10, 74], "fulljra": 61, "func": [38, 80], "function": [8, 10, 11, 12, 13, 14, 15, 16, 22, 28, 31, 33, 34, 40, 43, 44, 46, 47, 51, 53, 60, 67, 69, 71, 73, 74, 80, 82, 84, 86, 87, 93], "fund": [24, 63, 79], "fundament": [2, 16, 25, 42, 60], "fundrais": 63, "funnel": [30, 31, 32], "funni": 73, "funtion": 38, "further": [8, 20, 28, 29, 43, 47, 61, 67, 74], "futur": [6, 8, 10, 11, 20, 24, 29, 37, 46, 61, 63, 67, 74, 84, 87, 90], "future_cmip6": 46, "future_smbb": 46, "futurewarn": [61, 84, 87], "fv_0": [84, 87], "g": [0, 1, 6, 8, 10, 18, 20, 28, 45, 61, 71, 81, 86, 87, 90], "g1850eco_jra": 18, "g1850eco_jra_hr": 18, "gagn": 32, "gain": [29, 91], "galleri": [8, 23, 24, 46], "game": [8, 35, 74], "gap": [63, 84], "garbag": [12, 14], "garcia": 61, "gatewai": [8, 37], "gather": [8, 24, 25, 29, 41, 59, 62, 80], "gauss": 46, "gb": [7, 8, 17, 20, 29, 31, 41, 43, 47, 61, 84, 87], "gc": [80, 81], "gcc": [72, 83, 84, 86], "gear": [8, 15, 71, 74], "gen_corner_calc": 61, "gen_json": 84, "gen_ref": 86, "gener": [4, 6, 8, 13, 14, 15, 20, 23, 24, 28, 37, 39, 41, 43, 44, 50, 52, 53, 57, 61, 62, 63, 67, 69, 72, 80, 81, 83, 87, 88, 90], "generate_cbar": 61, "generate_json": 86, "generatornorm": [72, 83], "geo": [38, 63, 72], "geocat": [7, 8, 19, 24, 29, 39, 41, 48, 60, 75, 77, 90, 92], "geocat_comp_tutori": 33, "geocollect": 80, "geograph": 23, "geolat": 86, "geolat_c": 86, "geolat_u": 86, "geolat_v": 86, "geolon": 86, "geolon_c": 86, "geolon_u": 86, "geolon_v": 86, "geoquadmesh": 80, "geoscienc": [2, 6, 8, 10, 25, 30, 59, 60, 62, 77, 82, 93], "geoscientif": [8, 10, 29], "geoscientist": [2, 8, 74, 82], "geoview": [8, 32, 41], "get": [0, 6, 7, 8, 12, 13, 15, 16, 25, 28, 29, 31, 38, 43, 47, 57, 61, 63, 64, 67, 68, 71, 74, 75, 76, 77, 79, 80, 81, 83, 86, 87, 88, 90], "get_bound": 7, "get_bounds_dim_nam": 7, "get_clean_interp_index": 73, "get_directori": 20, "get_filelist": 20, "get_mapp": [84, 86], "get_templ": 15, "getitem": [46, 68], "getlogg": 46, "gf": [23, 41], "gfevyho4": 41, "gh": 44, "ghp": 50, "ght": 67, "giant": 73, "gib": [37, 38, 41, 46, 61, 67, 68, 72, 73, 80, 83, 84, 86, 87], "gift": 15, "giphi": 74, "gist": 73, "git": [0, 7, 8, 12, 16, 19, 21, 26, 27, 28, 33, 34, 38, 40, 50, 55, 56, 58, 60, 66, 67, 70, 78, 85, 92], "git_discovery_across_filesystem": 12, "git_repo": [20, 28, 50], "github": [0, 1, 4, 8, 10, 12, 18, 19, 21, 23, 26, 27, 28, 29, 33, 34, 38, 40, 49, 55, 56, 57, 58, 59, 60, 63, 64, 66, 67, 70, 73, 78, 83, 87], "github_token": 44, "github_usernam": 50, "githubusercont": [18, 36, 38, 46, 50], "gitignor": [8, 50, 69], "give": [6, 7, 10, 25, 28, 45, 63, 73, 81, 88], "given": [7, 8, 14, 17, 18, 23, 39, 41, 42, 44, 47, 51, 61, 64, 65, 67, 68, 74], "gjnimb52": 41, "gjrav3": 86, "glacier": 80, "glacier_mec": 80, "glade": [6, 7, 8, 20, 22, 23, 28, 37, 38, 39, 41, 42, 43, 44, 47, 50, 52, 61, 67, 68, 71, 72, 80, 83, 84, 86, 87, 90], "glc": 28, "glcnecctype_deep_lak": 80, "glob": [28, 41, 43, 44, 67, 84, 86, 87], "global": [8, 12, 14, 23, 36, 38, 40, 41, 46, 47, 61, 63, 80, 93], "global_ocean": 36, "globalintake_esm_attr": 38, "gmom": 86, "gmted2010": 67, "gn": 42, "gngr7asx": 41, "gnomon": 72, "go": [8, 10, 12, 15, 20, 25, 28, 29, 32, 37, 39, 41, 42, 44, 59, 63, 73, 77, 80, 86, 90], "goal": [8, 10, 16, 18, 24, 29, 32, 35, 59, 63, 74, 77, 84, 85, 88, 90, 92], "goe": 40, "gomipecoiaf_jra": 20, "good": [7, 8, 10, 12, 15, 16, 24, 28, 31, 36, 43, 45, 48, 53, 62, 63, 64, 71, 73, 74, 79, 82, 86, 87, 90], "googl": [6, 8, 15, 16, 19, 21, 24, 26, 27, 29, 33, 34, 35, 40, 49, 54, 55, 56, 57, 58, 60, 66, 70, 74, 75, 76, 77, 78, 82, 84, 88], "gordon": 63, "got": [15, 83, 90], "gouraud": 68, "gov": [46, 61], "govcreator_typ": 61, "govcreator_url": 61, "govern": [2, 24, 63], "govnodc_template_vers": 61, "gpcp_jja_climo": 41, "gpp": 80, "gpu": 80, "gracefulli": 45, "gradient": 38, "graduat": [2, 40], "gram": [36, 39], "grant": [29, 63], "grape": 80, "graph": [36, 43, 50, 62, 72, 73, 83, 84, 86, 87, 88], "graph_attr": [36, 50], "graphic": [23, 62], "graphviz": [8, 50], "grasp": [8, 74], "grassroot": 25, "graze_sp_zootot": 28, "great": [4, 6, 7, 8, 23, 25, 29, 42, 48, 51, 59, 64, 81, 84, 86, 87, 90], "greater": [8, 10, 15, 63, 88], "greatest": [10, 20], "green": [21, 50, 58, 65, 66], "greenfrac": 67, "greenland": [8, 23], "greet": 15, "gregorian": 11, "grew": 25, "grib2": 86, "grid": [8, 17, 24, 25, 32, 36, 38, 39, 41, 47, 63, 67, 72, 80, 84, 85, 86, 87, 92, 93], "grid1d_ixi": 80, "grid1d_jxi": 80, "grid1d_lat": 80, "grid1d_lon": 80, "grid_file_dst": [72, 83], "grid_file_src": [72, 83], "grid_loc": 68, "grid_map": 61, "grid_mapping_nam": 61, "grid_subset": 46, "grid_til": 86, "grid_typ": 86, "gridcel": 80, "gridlin": 81, "gridmap": 61, "gridpublisher_nam": 61, "gridstagg": 67, "gross": 80, "ground": 67, "groundnut": 80, "group": [4, 8, 10, 11, 17, 19, 21, 26, 27, 29, 32, 33, 34, 35, 40, 42, 49, 54, 55, 56, 58, 59, 60, 63, 66, 67, 70, 75, 77, 78, 81, 82, 85, 88, 90, 91, 92], "groupbi": [11, 20, 25, 28, 37, 38, 41, 46, 67, 68, 80, 81], "groupby_attr": [20, 28, 41], "groupcreator_institut": 61, "grover": [2, 8, 31, 32, 40, 58], "grow": [11, 25, 29], "grumpi": 74, "gt": [17, 23, 38, 39, 41, 46, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "gtopo30_0": 38, "gtopo30_ne12": 83, "gtopo30_ne120np4_16xdel2": [23, 72, 83], "guess": 11, "guid": [4, 7, 8, 24, 28, 42, 48, 59, 74, 90, 91], "guidanc": 24, "guidelin": [3, 12], "gv": [23, 81], "gw": [41, 46, 84], "gz": [20, 28, 41], "h": [15, 20, 23, 28, 39, 43, 61, 80], "h0": [7, 28, 41, 80], "h1": [37, 80, 87], "h2": 72, "h2o": 41, "h4": 83, "h5chunk": 84, "h5netcdf": 84, "h6": 84, "h_taqxfo": 37, "ha": [2, 6, 7, 8, 12, 13, 14, 15, 16, 17, 22, 25, 28, 29, 30, 31, 32, 37, 38, 39, 41, 45, 47, 48, 51, 59, 61, 62, 63, 65, 67, 68, 71, 72, 73, 74, 78, 80, 81, 82, 83, 84, 86, 87], "hack": 63, "hackathon": [77, 85], "hacki": 74, "had": [8, 11, 12, 14, 15, 30, 32, 62, 63, 79, 89, 90], "hadcrut4": 46, "hadcrut4refer": 46, "hadcrut4var_desc": 46, "hadisst_cl_03_climo": 41, "hadisst_pd_02_climo": 41, "hadisst_pi_05_climo": 41, "hadlei": 46, "hadob": 46, "haii": 25, "hailei": 89, "half": 73, "hall": [8, 32, 64], "hamman": [8, 46], "hand": [12, 15, 90], "handi": [51, 87], "handl": [52, 65, 73, 80], "hang": 17, "hannai": [41, 44], "hannayamwg_creation_d": 41, "happen": [8, 10, 11, 14, 28, 29, 45, 47, 69, 74, 76, 83, 90, 92], "happi": [23, 74], "hard": [7, 8, 11, 14, 15, 65, 67, 71, 74, 81, 87, 90], "hardcod": 72, "harri": 63, "has_year_zero": [38, 41, 46, 61, 68, 72, 80, 83, 84, 86, 87], "hasn": 73, "hat": 74, "hauser": 2, "have": [0, 1, 6, 8, 10, 11, 12, 14, 15, 16, 17, 18, 19, 20, 23, 24, 25, 26, 27, 28, 29, 30, 32, 35, 37, 38, 39, 41, 42, 43, 44, 45, 46, 49, 50, 51, 52, 54, 57, 61, 62, 63, 64, 65, 66, 67, 68, 69, 71, 72, 73, 74, 75, 77, 79, 80, 81, 82, 83, 84, 86, 87, 88, 89, 90], "haven": [50, 52], "hawaiian": 40, "hdf": [29, 84], "hdf5": [29, 62, 84, 86], "he": [8, 23, 40, 70, 78], "head": [15, 43, 56, 59], "headach": [8, 11, 73, 74, 81], "header": [12, 13, 44, 59, 63], "hear": 90, "heat": [36, 63], "heather": [2, 32, 76, 77], "heavi": [8, 47, 71], "height": [18, 23, 37, 39, 46, 61, 63, 67, 72, 81], "heightstagg": 67, "heighttime_avg_info": 86, "held": [15, 31, 63], "hello": 8, "help": [2, 6, 8, 10, 11, 16, 17, 20, 24, 25, 28, 29, 30, 32, 36, 37, 39, 41, 43, 46, 47, 50, 51, 57, 59, 61, 62, 65, 67, 68, 70, 71, 74, 76, 79, 80, 82, 84, 87, 88, 90, 92], "helpdesk": 7, "helper": [14, 46, 84, 86, 90], "henderson": 89, "her": [8, 19, 82], "herd": 29, "here": [1, 6, 7, 8, 10, 11, 12, 13, 14, 15, 18, 20, 22, 23, 24, 25, 32, 33, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 50, 51, 52, 53, 54, 57, 64, 65, 67, 68, 69, 72, 73, 74, 76, 77, 80, 81, 83, 84, 86, 87, 88, 91, 92], "heroku": 18, "heurist": [53, 86], "hgroup": 86, "hgt_m": 67, "hi": [20, 28, 40, 78], "hidden": [12, 45, 80, 86], "hide": [17, 44, 88], "hierarch": 25, "hierarchi": 86, "high": [6, 7, 8, 23, 24, 32, 39, 51, 72], "higher": [8, 23, 43, 68, 80, 83, 86], "highli": 6, "highlight": [8, 24, 33, 34], "highr": [8, 18], "hike": 40, "him": 40, "hire": [8, 28, 32, 37, 61], "hires1": 72, "hires_pop_obs_comparison": 61, "hist": [20, 28, 36, 44, 50], "hist_interv": 80, "histfilemod": 80, "histogram": 18, "histor": [8, 37, 46, 83, 84], "histori": [7, 8, 17, 23, 32, 35, 39, 41, 44, 46, 61, 62, 63, 80, 87], "historical_cmip6": 46, "historical_smbb": 46, "history_catalog": 20, "hit": [15, 71], "hksat": 80, "hmm": 73, "hmw": 12, "hmxl": 44, "hmxl_dr_2": 20, "hoc": [28, 63], "hold": [2, 6, 8, 12, 15, 24, 32, 39, 53, 74, 80, 87], "hole": 63, "holidai": 16, "holoview": [8, 20, 38, 41, 46, 61, 65, 67, 68, 83, 84], "holoviz": 18, "home": [6, 12, 23, 28, 37, 43, 51, 57, 84, 87], "homepag": [23, 51, 87], "homm": 83, "hone": 74, "hood": [37, 43, 83], "hook": 0, "hope": [8, 11, 36, 37, 43, 50, 57, 67], "hopefulli": [8, 12, 15, 47, 74, 80, 90], "horizon": 15, "horizont": [39, 61, 80, 81], "host": [1, 8, 11, 16, 19, 21, 26, 27, 33, 34, 38, 40, 46, 49, 51, 55, 56, 57, 58, 64, 66, 68, 70, 72, 75, 76, 77, 78, 83, 84, 85, 87, 88, 90, 91, 92], "hostnam": 80, "hour": [7, 8, 16, 23, 62, 63, 74, 81, 90, 92], "hour_6i": 72, "hourli": [8, 67, 81, 83], "hous": 6, "hover": [39, 46], "how": [2, 6, 8, 10, 11, 12, 13, 14, 15, 16, 20, 22, 23, 28, 30, 31, 32, 35, 37, 41, 42, 43, 45, 46, 48, 50, 51, 53, 59, 60, 61, 62, 63, 65, 67, 68, 69, 72, 73, 74, 76, 77, 80, 81, 86, 87, 88, 91], "howev": [8, 10, 14, 15, 20, 66, 71, 73, 80, 81], "hoyer": 17, "hpa": 67, "hpaarrai": 84, "hpabound": 72, "hpalong_nam": 41, "hpaposit": [41, 72, 83, 84], "hpc": [6, 8, 22, 31, 37, 38, 41, 43, 46, 52, 61, 62, 67, 68, 83, 84, 86, 87, 88, 90, 92], "hr": 72, "href": 18, "htmcalendar": 68, "htmhistori": 39, "htmintake_esm_varnam": 61, "html": [1, 8, 15, 20, 44, 50], "htmldods_extra": 46, "http": [1, 8, 12, 17, 18, 19, 22, 23, 26, 27, 28, 34, 35, 36, 37, 38, 39, 40, 41, 43, 46, 50, 51, 52, 55, 56, 61, 62, 63, 64, 67, 68, 70, 73, 78, 80, 83, 84, 86, 87], "hub": [6, 44], "huge": [8, 59, 63], "human": 65, "humanitarian": 15, "humbl": 25, "humid": 67, "humiditystagg": 67, "humor": 74, "hv": [20, 23, 28, 38, 39, 41, 46, 61, 65, 67, 68, 84], "hv_logo": 18, "hvd": 39, "hvplot": [8, 20, 31, 32, 38, 41, 44, 46, 65, 68, 72, 84], "hyai": [46, 72, 83, 84], "hyam": [38, 41, 46, 72, 83, 84], "hybi": [46, 72, 83, 84], "hybm": [38, 41, 46, 72, 83, 84], "hybrid": [8, 38, 41, 46, 72, 75, 77, 83, 84, 85, 90, 91, 92], "hypothesi": 20, "i": [2, 4, 6, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 53, 54, 55, 56, 57, 58, 59, 60, 62, 63, 65, 66, 68, 69, 70, 72, 75, 77, 78, 79, 81, 82, 83, 84, 85, 87, 88, 90, 93], "iag": 67, "ib": [8, 37], "ib0": [22, 43, 52, 87], "ic": [20, 28, 67, 87], "icon": [0, 21, 57, 58, 66, 71], "id": [22, 23, 28, 37, 38, 39, 43, 51, 52, 61, 63, 68, 72, 80, 83, 87], "idea": [0, 6, 8, 10, 25, 28, 31, 63, 74, 80, 86, 90], "ideal": [8, 18, 20, 46, 62, 79], "ident": [12, 17, 50, 74, 80, 83], "identifi": [2, 63, 64, 72, 86], "idl": [63, 87], "idntifi": 86, "ifrac": 44, "igbp": 67, "ignor": [15, 20, 43, 46, 84], "ignore_index": 20, "ihesp": 72, "ilev": [46, 72, 83, 84], "ilevpandasindexpandasindex": [72, 83, 84], "illinoi": 40, "illumin": [2, 8, 15], "illustr": [17, 43, 73, 83], "imag": [8, 18, 23, 39, 44, 48, 50, 72, 73, 80, 88, 91], "imageri": [25, 40], "imagin": [15, 38], "img": [18, 64], "immedi": [47, 74, 75], "impact": [2, 63, 68], "imperv": 67, "impervi": 67, "implement": [6, 8, 10, 38, 39, 47, 68, 73, 74, 81, 87, 93], "impli": 73, "implic": [8, 22], "import": [7, 8, 15, 18, 22, 25, 29, 31, 32, 42, 44, 45, 51, 52, 59, 62, 63, 69, 71, 72, 73, 74, 86, 87, 88], "important_not": 38, "impost": [8, 74], "impress": 20, "improv": [2, 7, 8, 10, 25, 39, 59, 60, 62, 73, 84, 90], "in_shap": [72, 83], "inaccur": 81, "inc": 15, "inch": [48, 81], "includ": [2, 4, 6, 7, 8, 11, 18, 20, 22, 23, 24, 25, 28, 29, 32, 36, 37, 38, 39, 41, 42, 43, 44, 45, 46, 50, 51, 57, 59, 61, 62, 63, 67, 68, 69, 71, 77, 80, 83, 86, 90, 92, 93], "includi": [8, 72], "inclus": [2, 13, 25, 63, 92], "incom": 41, "incopor": 63, "incorrect": 68, "incorrect_plot": 68, "increas": [2, 8, 23, 29, 37, 43, 47, 72], "incud": 39, "inde": 86, "indent": 13, "independ": [80, 86], "index": [1, 7, 8, 11, 13, 15, 16, 25, 32, 46, 50, 56, 67, 69, 72, 80, 81, 83, 84, 86, 87], "indic": [36, 57, 67, 83], "indirectli": 63, "individu": [6, 8, 39, 42, 43, 62, 76, 77, 79, 86, 87, 92], "industri": 63, "ineffici": 62, "inevit": 25, "infer": [14, 48], "inferno": [67, 81], "infil": 84, "infiltr": 17, "influenc": 61, "influenti": 63, "info": [25, 28, 37, 38, 41, 46, 61, 67, 68, 73, 80, 83, 84, 86, 87], "info_list": 41, "infor": 61, "inform": [0, 2, 4, 6, 8, 11, 13, 15, 16, 19, 21, 22, 24, 26, 27, 28, 29, 33, 34, 35, 38, 39, 41, 49, 50, 54, 55, 56, 57, 58, 59, 60, 61, 65, 66, 67, 70, 71, 72, 75, 78, 80, 81, 82, 83, 86, 90], "informat": [8, 10], "informationcom": 80, "informationproject": 61, "informationpublisher_typ": 61, "infrar": 63, "infrastructur": [25, 59, 63, 91], "ingest": 90, "inherit": 88, "inic": 83, "init": [11, 12, 35], "initi": [1, 2, 3, 6, 7, 12, 13, 17, 25, 29, 36, 38, 40, 77, 87, 93], "initial_condit": 20, "initial_fil": [23, 38, 51, 72, 83, 84], "inject": 44, "inlin": [43, 46, 50, 80], "inline_threshold": [84, 86], "innov": [2, 63], "inport": 52, "input": [7, 8, 14, 15, 22, 23, 29, 43, 44, 48, 50, 51, 52, 53, 59, 71, 72, 73, 80, 83, 87], "input_core_dim": 80, "inputdata": [23, 38, 51, 61, 72, 80, 83, 90], "inquiri": 29, "insert": [15, 72, 83], "insid": [12, 15, 25], "insight": [24, 25, 41, 74], "inspect": [42, 67, 71], "inspector": 71, "inspir": [2, 8, 10, 17, 93], "instal": [1, 7, 8, 12, 15, 19, 21, 23, 24, 26, 27, 28, 35, 36, 40, 44, 45, 49, 52, 54, 55, 56, 57, 58, 61, 66, 69, 70, 71, 78, 82], "installt": 7, "instanc": [7, 12, 84], "instant": 80, "instantan": 17, "instanti": 38, "instantli": 23, "instead": [7, 8, 10, 11, 12, 14, 15, 25, 36, 38, 43, 44, 45, 50, 52, 53, 62, 68, 73, 84, 87], "institut": [8, 10, 41, 61], "institutionpublisher_url": 61, "instruct": [7, 8, 19, 21, 26, 27, 40, 48, 49, 50, 54, 55, 56, 58, 59, 62, 64, 66, 70, 73, 75, 77, 78], "instructor": 62, "instructuion": 82, "instrument": 63, "int": [28, 37, 41, 73, 80, 83], "int32": [41, 46, 61, 65, 72, 83], "int320arrai": 65, "int320long_nam": 46, "int321": 72, "int321480550400arrai": 65, "int321543505128": 46, "int321arrai": 41, "int32300arrai": 65, "int32dask": [46, 72, 83], "int64": [38, 61, 68, 72, 73, 80], "int640": [73, 80], "int641": [38, 61, 73, 80], "int641arrai": 61, "int642015": 68, "int64index": 72, "intak": [8, 25, 31, 32, 44, 61, 82, 86], "intake_esm": 38, "intake_esm_attr": 38, "intake_esm_dataset_kei": [28, 38, 39, 46, 61], "intake_esm_varnam": [28, 39, 46, 61], "intarrai": 17, "integ": [14, 36, 53, 67, 80], "integr": [2, 8, 10, 25, 39, 64, 72], "intend": [71, 74], "intens": [2, 63], "interact": [2, 8, 23, 24, 35, 39, 41, 46, 57, 59, 62, 63, 67, 85, 90, 92], "interactive_plot_templ": 44, "interactiveshel": [37, 41], "intercomparison": 42, "interest": [2, 7, 8, 18, 20, 23, 24, 28, 29, 31, 32, 37, 39, 41, 42, 43, 44, 46, 51, 59, 62, 63, 64, 65, 68, 74, 80, 81, 85, 88, 90, 91], "interfac": [8, 22, 25, 36, 43, 44, 46, 52, 59, 62, 72, 83, 84, 87], "interfaceposit": 86, "interlink": 2, "intermedi": [8, 23, 70, 84], "intern": [8, 72, 86], "internship": 40, "interp": 61, "interp1d": 47, "interp_method": 86, "interp_mld_dsigma": 47, "interpol": [8, 32, 63, 81, 83, 90], "interpret": [63, 86, 87], "interv": [6, 23, 38, 39, 61, 65, 68, 72, 80, 83, 84], "intrins": 2, "intro": [44, 75, 77], "introduc": [8, 16, 30, 70, 82, 91], "introduct": [8, 21, 26, 27, 29, 35, 49, 51, 54, 55, 58, 60, 66, 82], "introductori": 92, "invalid": 28, "invalid_asset": [20, 28, 41], "invalid_assets_amwg_obs_dataset": 41, "invalid_assets_cesm": [20, 28], "invar_flat": 83, "invari": [28, 86, 87], "invers": 41, "invest": 24, "investig": [8, 20, 36, 37, 42, 44, 47], "invidu": 63, "invit": [6, 88], "invok": 71, "involv": [6, 38, 59, 76, 86, 87], "io": [1, 50, 63, 64, 67], "iowa": 63, "ipnyb": 44, "ipykernel": [7, 71], "ipykernel_140729": 41, "ipykernel_197849": 20, "ipykernel_20245": 80, "ipykernel_launch": 28, "ipynb": [0, 8, 40, 44, 49, 50, 56, 59, 71, 80], "ipython": [20, 37, 41, 63, 72, 73, 80], "irradi": 63, "irradianceunit": [72, 83, 84], "irregular": [25, 51], "irrig": 67, "irrigated_barlei": 80, "irrigated_cassava": 80, "irrigated_citru": 80, "irrigated_cocoa": 80, "irrigated_coffe": 80, "irrigated_cotton": 80, "irrigated_datepalm": 80, "irrigated_foddergrass": 80, "irrigated_grap": 80, "irrigated_groundnut": 80, "irrigated_millet": 80, "irrigated_miscanthu": 80, "irrigated_oilpalm": 80, "irrigated_potato": 80, "irrigated_puls": 80, "irrigated_rapese": 80, "irrigated_ric": 80, "irrigated_ry": 80, "irrigated_sorghum": 80, "irrigated_spring_wheat": 80, "irrigated_sugarbeet": 80, "irrigated_sugarcan": 80, "irrigated_sunflow": 80, "irrigated_switchgrass": 80, "irrigated_temperate_corn": 80, "irrigated_temperate_soybean": 80, "irrigated_tropical_corn": 80, "irrigated_tropical_soybean": 80, "irrigated_winter_barlei": 80, "irrigated_winter_ry": 80, "irrigated_winter_wheat": 80, "is_lett": 15, "isccp": 72, "isccp_12_climo": 41, "isccpcosp_07_climo": 41, "isccpfd_07_climo": 41, "isel": [7, 23, 28, 38, 39, 41, 43, 47, 61, 67, 68, 72, 80, 81, 83, 84], "isel_dict": 18, "isinst": [72, 83], "isn": [8, 28, 45, 46, 67, 69, 74, 84], "isnan": 47, "isnul": [46, 47, 68], "iso": 61, "isol": 73, "issu": [6, 7, 8, 11, 12, 13, 17, 25, 28, 29, 39, 42, 43, 45, 48, 51, 53, 62, 65, 67, 73, 83, 90], "item": [6, 13, 15, 17, 20, 41, 43, 72, 80, 83, 86, 87], "iter": [2, 8, 13, 14, 41], "itertool": 17, "itim": 80, "its": [2, 14, 17, 28, 50, 59, 69, 74, 77, 80, 81], "itself": [8, 10, 15, 29, 38, 64, 74], "iv": [72, 83, 84, 86], "ivt": 72, "ixi": 80, "j": [1, 61], "j2": 15, "jain": 92, "jam": 92, "jan": [41, 46, 84], "jane": 15, "januari": [7, 8, 10, 16, 61, 80, 81, 85, 92], "jaroszynski": [76, 77, 92], "java": 63, "jb": 44, "jbuseck": 4, "jessica": 89, "jet": 83, "jgr": 17, "jhamman": 17, "jja": [41, 81], "jkent": [75, 88], "job": [7, 8, 11, 28, 31, 40, 41, 43, 44, 47, 52, 63, 87], "job_extra": 84, "job_extra_direct": 84, "job_script_prologu": 84, "joblib": 28, "jobqueu": [8, 20, 22, 25, 30, 31, 32, 43, 62], "joe": [8, 15, 46], "john": [2, 32, 92], "johnson": 89, "join": [6, 8, 10, 19, 21, 26, 27, 33, 34, 35, 40, 49, 54, 55, 56, 58, 66, 70, 78, 82], "join_exist": [20, 28], "join_new": 41, "jone": 89, "joss": 63, "jour": 29, "journal": 63, "journei": [8, 11, 62], "jpg": [48, 50], "jra25_son_climo": 41, "json": [20, 28, 36, 37, 38, 39, 41, 42, 43, 44, 46, 50, 61, 72, 83, 84, 86], "json_dir": 84, "judt": [2, 92], "jul": 41, "juli": [8, 26, 27, 82], "julia": [2, 10, 29, 32, 63, 75, 76, 77, 82, 88, 92], "juliu": [4, 25, 32], "jump": [20, 41], "june": [8, 28, 37, 66, 82, 91], "jupyt": [4, 6, 7, 8, 12, 19, 21, 25, 26, 27, 31, 32, 33, 34, 40, 46, 49, 50, 53, 54, 55, 56, 59, 60, 63, 66, 70, 75, 78, 82, 83, 92], "jupyter_tutori": [49, 54], "jupyterbook": [8, 32, 39, 44, 59], "jupyterhub": [6, 8, 22, 25, 37, 38, 41, 43, 46, 50, 52, 57, 61, 62, 67, 68, 83, 84, 85, 86, 87], "jupyterlab": [0, 6, 8, 19, 26, 27, 33, 34, 36, 40, 45, 49, 54, 56, 62, 66, 70, 71, 78, 86, 87], "just": [7, 8, 10, 12, 13, 14, 21, 22, 29, 35, 37, 38, 41, 43, 45, 46, 50, 58, 61, 63, 64, 66, 67, 68, 69, 73, 74, 79, 83, 84, 86, 87, 88, 90], "justifi": 14, "jxy": 80, "k": [23, 41, 46, 47, 61, 71, 72, 80, 81, 83, 84, 86], "kai": [8, 31], "karrai": 46, "katelyn": [2, 92], "kati": [2, 76, 77], "kb": 17, "kdagon": 83, "kdescript": 67, "kdtree_sel": 51, "keep": [7, 8, 20, 25, 29, 38, 39, 61, 62, 68, 74, 78], "keep_attr": [39, 80], "keep_var": 43, "kei": [15, 17, 18, 20, 25, 28, 29, 32, 37, 38, 39, 41, 42, 43, 46, 47, 61, 63, 67, 86, 90], "kelvin": 38, "kelvindescript": 67, "kent": [2, 10, 32, 75, 76, 77, 82, 88, 92], "kerchunk": 8, "kernel": [7, 45, 63, 71], "kernel_nam": [44, 71], "kevin": [2, 8, 31, 35, 56, 89], "keynot": 25, "keyward": 15, "keyword": [11, 48, 74, 83], "kg": [67, 72, 86], "kib": [38, 46, 67, 68, 72, 73, 80, 83, 84, 86, 87], "kibi9ldk": 41, "kick": 92, "kickoff": [8, 32], "kill": [8, 25, 43], "killer": 25, "kilogram": 36, "kilogramgrid_loc": 39, "kind": [15, 81, 88, 90], "king": [2, 92], "klong_nam": [23, 41, 83, 84], "km": 80, "kmpaul": 56, "kmt": 43, "know": [7, 12, 14, 16, 31, 36, 53, 65, 68, 69, 74, 79, 80, 83, 87, 88], "knowledg": 2, "known": [7, 59, 78], "ko": [8, 12], "kootz": [8, 33, 34, 54, 55, 76, 77], "kpp": 86, "kpptime_avg_info": 86, "krill": [8, 43], "kristen": [8, 43], "kristenk": 43, "krumhardt": [8, 43], "kubeclust": 62, "kumar": 25, "kwarg": [42, 47, 68, 80, 86, 87], "kxarrai": 46, "l": [15, 71], "l9t684r1": 41, "lab": [2, 4, 6, 8, 10, 19, 26, 27, 29, 30, 33, 34, 40, 44, 45, 55, 56, 64, 66, 67, 70, 75, 77, 78, 85, 88, 90, 91, 92], "label": [8, 15, 20, 23, 36, 37, 46, 47, 50, 63, 65, 68, 70, 73, 81], "labels": 81, "labor": 63, "laboratori": 10, "laboratorycontributor_rol": 61, "laboratorycreator_email": 61, "lack": 67, "lai": 67, "lai12m": 67, "laistagg": 67, "lake": [40, 80], "lake_depth": 67, "land": [8, 28, 59, 67, 81, 86], "land1d_act": 80, "land1d_gi": 80, "land1d_ityplunit": 80, "land1d_ixi": 80, "land1d_jxi": 80, "land1d_lat": 80, "land1d_lon": 80, "land1d_wtgcel": 80, "landfrac": 80, "landmask": [67, 80], "landsea": 67, "landunit": 80, "landunitflag_valu": 80, "landus": 67, "landusef": 67, "landusestagg": 67, "langlei": 41, "languag": [8, 10, 14, 16, 29, 63, 82], "larg": [2, 7, 8, 17, 23, 24, 25, 31, 36, 37, 38, 41, 42, 43, 62, 63, 67, 68, 73, 81, 84, 86, 87], "larger": [28, 51, 63, 68], "largest": 62, "last": [8, 11, 15, 17, 28, 29, 32, 38, 41, 42, 52, 54, 59, 61, 63, 67, 72, 80, 84, 88, 90], "lat": [8, 23, 25, 37, 38, 41, 46, 51, 61, 65, 72, 73, 80, 81, 83, 84, 87], "lat2d": 83, "lat_b": 61, "lat_bnd": [46, 61], "lat_bndsarrai": 61, "lat_bndslong_nam": 38, "lat_corn": 61, "lat_shap": 61, "latb": 83, "late": 11, "later": [6, 7, 12, 13, 28, 57, 61, 63, 68, 74, 83, 86, 87], "latest": [8, 44, 66, 80], "latitud": [17, 23, 41, 46, 51, 61, 67, 72, 73, 80, 81, 83, 84, 86], "latitude_chunks": 46, "latitude_longitudeepsg_cod": 61, "latitudeactual_rang": 81, "latitudearrai": 41, "latitudeaxi": 81, "latitudedescript": 67, "latitudelong_nam": [61, 87], "latitudestandard_nam": [38, 41], "latitudesunit": [39, 61], "latitudeunit": [23, 38, 41, 46, 61, 72, 80, 83, 84, 86, 87], "latpandasindexpandasindex": [72, 81, 83, 84, 87], "latter": 72, "launch": [8, 19, 26, 27, 33, 34, 40, 44, 45, 55, 56, 57, 66, 70, 75, 78, 86, 87], "lauritzen": 72, "law": 15, "layer": [8, 25, 46, 63, 67, 72, 80, 83, 84, 86, 87], "layerposit": [61, 68], "layerstagg": 67, "layertime_avg_info": 86, "layerunit": [39, 61], "layout": [35, 39, 65, 68], "lazi": [25, 67, 84], "lazili": [38, 68, 84], "lcpo": 2, "ldeo": 32, "le": [7, 8, 24, 31, 32, 38, 46, 84, 87], "le2": [84, 87], "lead": [2, 6, 8, 11, 17, 31, 62, 63, 73, 79, 84, 93], "leader": [75, 77], "leadership": [6, 63], "leak": 14, "leap": [11, 16], "learn": [2, 4, 8, 12, 15, 16, 29, 32, 37, 60, 62, 63, 65, 68, 75, 78, 82, 88, 91], "learnpython": [19, 21, 26, 27, 33, 34, 35, 40, 49, 54, 55, 56, 58, 60, 66, 70, 78, 82], "least": [15, 61, 90], "leav": [15, 18, 50], "led": [8, 19, 21, 26, 27, 32, 33, 34, 35, 40, 43, 49, 54, 55, 56, 58, 63, 66, 70, 78], "left": [12, 36, 48, 50, 57, 59, 65, 81, 88], "lefthand": [50, 57], "lefttitl": 81, "lefttitlefonts": 81, "legaci": 10, "legates_04_climo": 41, "legend": [37, 46, 47, 65, 73], "legend_posit": 65, "lego": 25, "len": [8, 11, 17, 18, 23, 29, 36, 37, 38, 41, 46, 47, 61, 68, 72, 80, 83, 84, 86, 87], "length": [8, 11, 14, 46, 53, 61, 65, 67, 68, 72, 81, 83, 84, 86, 87], "lens2": [8, 37, 46], "less": [7, 10, 15, 25, 45, 47, 68, 74, 88], "lesser": 17, "lesson": [8, 25, 56, 62, 70, 78, 82], "let": [7, 10, 11, 14, 15, 16, 17, 20, 23, 25, 28, 35, 36, 37, 38, 39, 41, 42, 46, 47, 61, 67, 68, 79, 80, 83, 84, 87], "letter_bodi": 15, "lev": [2, 7, 38, 41, 46, 61, 72, 83, 84], "levdcmp": 80, "level": [2, 8, 37, 38, 39, 40, 41, 46, 48, 51, 56, 59, 70, 72, 78, 80, 81, 83, 84, 86], "level_desc": 81, "levelarrai": [38, 46], "levelsunit": 80, "leverag": [8, 24, 29, 61, 91], "levgrnd": 80, "levi": [2, 10, 32, 92], "levlak": 80, "levpandasindexpandasindex": [72, 83, 84], "lh": 73, "liang": 17, "lib": [28, 37, 38, 41, 61, 67, 68, 80, 84, 87], "librari": [4, 7, 23, 29, 39, 47, 50, 53, 64, 68, 71, 84, 86], "licens": [50, 61], "lidar": [63, 72], "lift": [8, 71], "lightblu": 65, "lighten": 65, "lighter": 62, "lightgrai": 61, "lightgrei": 46, "lightweight": 45, "like": [0, 6, 7, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 21, 22, 25, 26, 27, 28, 33, 34, 35, 36, 38, 42, 43, 44, 45, 47, 49, 50, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 66, 67, 69, 70, 71, 72, 73, 74, 76, 78, 79, 80, 81, 82, 83, 84, 86, 88, 93], "limit": [2, 8, 25, 29, 37, 39, 50, 63, 73, 88], "linalg": 73, "line": [8, 12, 13, 15, 23, 39, 45, 46, 47, 50, 52, 61, 65, 73, 74, 81, 86], "line_width": 46, "linear": [8, 47, 73], "linearli": 47, "linearsegmentedcolormap": 61, "linewidth": 47, "link": [3, 6, 8, 19, 21, 22, 26, 27, 32, 33, 34, 35, 40, 43, 44, 46, 49, 52, 54, 55, 56, 57, 58, 59, 60, 62, 63, 64, 65, 66, 70, 75, 76, 78, 82, 86, 89, 91], "linspac": [53, 61, 81], "liq": 87, "list": [7, 8, 13, 15, 17, 20, 28, 29, 32, 37, 39, 41, 42, 43, 44, 45, 49, 51, 53, 55, 61, 62, 69, 74, 80, 83, 86, 92, 93], "listen": [6, 74, 90], "liter": 15, "literaci": 2, "literal_ev": [20, 28, 39, 41, 61], "literatur": [8, 64], "littl": [35, 73, 86, 87, 90], "live": [8, 21, 49, 53, 54, 55, 57, 63, 65, 79, 90], "ll": [15, 28, 38, 41, 44, 46, 61, 65, 68, 72, 73, 79, 80, 81, 83, 84, 86, 87, 88], "lmd": 86, "lnd": [17, 28, 80, 86], "load": [7, 25, 30, 41, 43, 61, 63, 65, 67, 71, 72, 80, 83, 84, 86, 87, 93], "load_ext": [72, 83, 84, 86], "loader": 15, "loc": [18, 20, 36, 47, 50], "local": [0, 19, 21, 22, 26, 27, 37, 40, 41, 43, 50, 52, 55, 56, 58, 59, 63, 70, 72, 73, 78, 86], "local_directori": [22, 43, 52, 87], "local_scratch": 87, "localclust": [73, 86], "localhost": 1, "locarnini": 61, "locat": [8, 14, 20, 28, 41, 47, 65, 72, 75, 80, 85, 87, 90, 91], "lock": 57, "log": [7, 20, 28, 35, 46, 50, 90], "log_directori": 87, "logger": 46, "logic": [12, 74], "login": 25, "login1": 72, "lognam": [72, 83, 84, 87], "logo": 18, "lokybackend": [20, 28], "lon": [8, 23, 25, 37, 38, 41, 46, 51, 61, 65, 72, 73, 80, 81, 83, 84, 87], "lon2d": 83, "lon_b": 61, "lon_bnd": [46, 61], "lon_bndsarrai": 61, "lon_corn": 61, "lon_shap": 61, "lonb": 83, "long": [2, 8, 10, 14, 15, 17, 20, 30, 32, 38, 43, 45, 46, 62, 63, 68, 73, 74, 78, 88], "long_nam": [7, 11, 17, 20, 23, 36, 37, 38, 39, 41, 43, 46, 47, 61, 68, 72, 80, 81, 83, 84, 86, 87], "long_term_averag": 20, "long_term_mean": 20, "longer": [7, 8, 10, 12, 14, 29, 63, 68, 79], "longest": 20, "longitud": [17, 23, 51, 61, 67, 72, 73, 80, 81, 83, 86], "longitude_chunks": 46, "longitudeactual_rang": 81, "longitudearrai": 41, "longitudeaxi": 81, "longitudedescript": 67, "longitudelong_nam": [61, 87], "longitudestandard_nam": 41, "longitudesunit": [39, 61], "longitudeunit": [23, 38, 41, 46, 61, 72, 80, 83, 84, 86, 87], "longwav": [36, 41, 63], "lonpandasindexpandasindex": [72, 81, 83, 84, 87], "look": [0, 6, 8, 11, 12, 15, 17, 18, 20, 23, 24, 25, 28, 29, 35, 36, 39, 41, 42, 43, 46, 50, 51, 57, 59, 61, 63, 65, 67, 69, 72, 74, 75, 77, 80, 81, 83, 84, 85, 86, 87, 88, 90], "loom": 15, "loop": [7, 13, 14, 16, 31, 37, 47, 50, 67, 80, 83, 87], "lose": 45, "lossi": 38, "lost": 74, "lot": [6, 8, 10, 12, 15, 29, 45, 63, 72, 73, 74, 86, 89, 90], "low": [24, 88], "low_memori": [37, 41], "lower": 68, "lowercas": 37, "lowest": 37, "lr": [36, 50, 73], "lstsq": 73, "lt": [17, 23, 38, 39, 41, 46, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "ltrh": 71, "lu_index": 67, "luca": [8, 32, 86], "luck": 74, "lucki": [8, 90], "luckili": [81, 87], "lump": 67, "lunch": [77, 88], "lunit": 41, "lustr": [84, 87], "lvvvvvvaap": 86, "lwcf": 41, "m": [0, 1, 7, 14, 15, 17, 23, 38, 40, 41, 43, 46, 47, 51, 61, 65, 67, 68, 71, 72, 74, 80, 83, 84, 86, 87, 88], "m2": [36, 46, 72, 83, 84, 86], "m222qwsu": 41, "m2arrai": 46, "m2xarrai": 46, "m3": [67, 86], "mac": [12, 45], "machin": [2, 7, 18, 28, 32, 35, 52, 57, 62, 63, 75], "made": [7, 8, 12, 31, 37, 44, 48, 66, 80, 82, 88], "magic": [7, 68, 86], "magma": [23, 39, 41, 68], "mai": [0, 2, 6, 7, 8, 11, 13, 15, 17, 20, 24, 25, 29, 33, 34, 35, 38, 40, 41, 43, 45, 56, 57, 58, 60, 62, 63, 68, 70, 74, 78, 79, 81, 82, 84, 87, 89], "mail": 15, "main": [0, 8, 17, 23, 39, 44, 46, 50, 59, 61, 62, 72, 73, 75, 77, 82, 83, 84, 85, 86], "maintain": [8, 11, 23, 63, 70, 71, 78, 90], "mainten": [2, 63], "maintitl": 81, "major": [2, 59, 81], "make": [0, 1, 2, 4, 6, 7, 8, 10, 11, 12, 15, 16, 17, 18, 21, 22, 23, 24, 25, 28, 29, 30, 31, 35, 37, 39, 44, 45, 50, 51, 52, 57, 58, 59, 62, 63, 67, 68, 70, 71, 72, 73, 74, 75, 76, 78, 86, 88, 89, 90, 92], "mam": [41, 81], "mam3_0": 83, "mam3_0000": 83, "mamba": 71, "manag": [7, 8, 12, 14, 22, 24, 25, 29, 63, 81, 93], "mani": [2, 7, 8, 10, 11, 12, 15, 17, 20, 22, 24, 25, 29, 31, 35, 39, 43, 46, 47, 48, 52, 60, 61, 62, 68, 73, 79, 86, 87, 88, 89, 90, 93], "manifest": 7, "manipul": [8, 11, 16, 48, 86], "manner": 80, "manual": [28, 45, 80], "map": [8, 18, 23, 31, 38, 39, 41, 48, 60, 63, 71, 86, 93], "map_block": [8, 32, 80], "map_fil": 83, "map_method": [72, 83], "map_ne120_to_0": [72, 83], "map_path": 83, "map_proj": 67, "mapfac_m": 67, "mapfac_mi": 67, "mapfac_mx": 67, "mapfac_u": 67, "mapfac_ui": 67, "mapfac_ux": 67, "mapfac_v": 67, "mapfac_vi": 67, "mapfac_vx": 67, "mapfactor": 67, "mapfil": [72, 83], "mar": [41, 71, 83], "marbl": [18, 28, 32, 37, 44, 47], "march": [8, 11, 41, 49, 54, 60, 70, 81], "margin": 63, "maria": 32, "mark": 45, "markdown": 39, "marker": 47, "market": [15, 63], "marrai": [46, 80], "marshal": 89, "martin": 89, "martinez": 76, "mask": [31, 63, 68, 80], "mask_a": [72, 83], "mask_b": [72, 83], "mass": [67, 86], "massiv": [8, 37], "master": [18, 36, 38], "match": [11, 15, 41, 61, 74, 81, 87], "materi": [1, 6, 8, 59, 65, 66, 77, 87], "math": [8, 16, 69], "mathwork": 63, "matplotlib": [8, 19, 21, 23, 34, 37, 39, 41, 43, 46, 47, 54, 60, 61, 72, 73, 80, 81, 84, 93], "matplotlib_tutori": 49, "matplotlibdeprecationwarn": 68, "matric": 25, "matrix": [44, 80], "matt": [2, 8, 10, 30, 32, 43], "matter": 83, "matthew": [8, 10], "max": [2, 8, 31, 32, 39, 40, 43, 48, 58, 61, 65, 73, 80, 88, 89], "max_diff": 61, "maximum": [28, 37, 48, 67, 87], "maximum_job": [83, 87], "mayb": [15, 25, 47, 88, 90], "mb": [7, 17, 41, 43, 61], "mbar": 37, "mbound": 72, "mcdate": 80, "mcsec": 80, "mct": 61, "md": [0, 1, 8, 64, 75], "mdcur": 80, "mdescript": 67, "mdim": [41, 84], "mdt": [8, 41, 66, 72, 83, 84], "mdtf": [24, 44], "me": [8, 11, 12, 15, 74], "mea": 92, "mean": [7, 10, 11, 12, 13, 14, 15, 20, 23, 24, 25, 28, 29, 31, 35, 37, 39, 44, 63, 67, 68, 72, 73, 74, 80, 81, 83, 84, 86, 87, 93], "meancoordin": 68, "meangrid_loc": 61, "meangrid_map": 61, "meaning": 23, "meaningless": 46, "meaninterp_method": 86, "meanlong_nam": [38, 46, 84, 86], "meanparent_stat": 81, "meansstandard_nam": 41, "meanstandard_nam": 81, "meant": [8, 31, 35, 67, 90], "meanxarrai": [41, 80, 87], "measur": [11, 46, 61, 63], "mecj2384": 41, "medeiro": 32, "median": 46, "meet": [8, 12, 29, 32, 59, 75, 77, 79, 90], "melodi": 24, "mem": [22, 43, 46, 52, 87], "member": [6, 7, 8, 10, 32, 37, 40, 43, 46, 47, 68, 84, 87, 90], "member_id": [20, 37, 38, 39, 41, 43, 46, 47, 61, 68], "membersprecis": 46, "memori": [8, 12, 14, 17, 20, 22, 25, 37, 38, 41, 43, 46, 47, 52, 61, 62, 67, 68, 73, 80, 83, 84, 86, 87], "men": 63, "mention": [8, 11, 12, 28, 32, 37, 39, 47, 57, 61, 62, 67, 68, 84], "mentor": [29, 74], "menu": 18, "menu_background": 18, "menu_text": 18, "merg": [0, 18, 35, 38, 39, 42, 46, 47, 63, 65, 72, 83, 86], "merge_ds_cmip6": 46, "merge_ds_smbb": 46, "merge_var": 86, "merged_d": 39, "meridion": [38, 86], "merra_12_climo": 41, "merraw_19x2_09_climo": 41, "mesa": [8, 30, 75, 77, 85, 90, 91, 92], "mesh": [23, 30, 72, 90], "meshgrid": 23, "mesonet": 63, "mesoscal": [40, 67], "mess": 86, "messag": [0, 6, 7, 12, 45, 80], "met": [8, 10, 63], "meta": [17, 28, 38, 39, 41, 46, 61, 67, 68, 72, 73, 74, 80, 83, 84, 86, 87], "metadata": [8, 28, 36, 64, 72, 80, 84, 86, 87], "metadata_link": 61, "metar": 40, "meteorolog": [23, 81], "meteorologi": [40, 67], "meter": [61, 65, 67, 86], "meters2": 67, "metersarrai": 86, "metersaxi": 61, "metersdescript": 67, "metgrid": 67, "method": [1, 7, 8, 11, 12, 25, 28, 29, 36, 37, 38, 39, 41, 46, 47, 50, 51, 53, 65, 67, 68, 72, 73, 74, 81, 86, 87, 90], "metoffic": 46, "metpi": [7, 8, 32, 40, 63, 65], "metplu": 24, "metric": [8, 47], "mgeospatial_vertical_resolut": 61, "mgrover": [20, 28, 37, 38, 39, 41, 46, 50, 61, 62, 67, 68], "mgrover1": [50, 58], "mi2rvi7_": 37, "mib": [38, 39, 41, 46, 61, 67, 68, 72, 73, 80, 83, 84, 86, 87], "michael": 10, "michaela": [8, 21], "michaelav": 21, "michaelsa": [8, 21], "micropuls": 63, "microscal": 67, "microsoft": 84, "mid": [8, 32, 37], "middl": 18, "midpoint": [38, 39, 41, 46, 61, 68, 72, 83, 84], "might": [7, 8, 15, 38, 39, 42, 44, 46, 73, 74, 88], "mike": [2, 32, 92], "mileston": 59, "millet": 80, "million": [37, 63], "mimick": 83, "min": [48, 61, 63, 84], "min_diff": 61, "mind": [8, 15, 20, 38, 39, 61, 62], "mine": [8, 15], "miniconda": [7, 8, 12, 45, 71, 75], "miniconda3": [28, 37, 38, 41, 61, 67, 68, 80, 84, 87], "minim": [7, 20, 28, 41, 43, 61, 83, 84, 87], "minimum": [25, 32, 37, 44, 48, 63, 64], "minimum_job": [83, 87], "minor": [68, 81], "minu": 61, "minut": [20, 47, 65], "misbehav": 7, "miscanthu": 80, "mishonov": 61, "mismatch": 47, "misrcosp_jja_climo": 41, "miss": [11, 13, 42, 62, 63, 68, 73], "mission": 2, "misunderstood": [8, 74], "mix": [8, 37, 41, 72, 83, 84, 86], "mixpod": 86, "mixpodsdimens": 86, "mkdir": [50, 86], "ml": 77, "mlab": 65, "mld": 47, "mld_dsigma": 47, "mld_sigma": 47, "mld_stack": 47, "mlotst": 86, "mlsg_10_climo": 41, "mlso_ann_climo": 41, "mlsw": 41, "mlsw_mam_climo": 41, "mm": 11, "mmm": 2, "mnmean": 81, "mnt": [84, 87], "mobil": 40, "mode": [17, 44, 71, 83, 84], "model": [2, 6, 8, 10, 11, 17, 20, 23, 24, 28, 30, 32, 36, 37, 38, 39, 40, 42, 44, 46, 47, 62, 67, 72, 73, 75, 76, 83, 90], "model_d": 61, "model_document": 50, "model_doi_url": [28, 39, 61, 68, 84, 87], "model_monthly_mean": 61, "modelhostnam": 80, "modern": [2, 8, 10], "modi": 67, "modif": [51, 87], "modifi": [7, 8, 15, 20, 39, 43, 44, 53, 72, 73, 84, 86, 87], "modified_igbp_modis_noahnum_land_cat": 67, "modify_markdown_head": 44, "modis_ann_climo": 41, "modul": [7, 8, 16, 69, 71, 80, 87], "modular": [24, 30, 31], "mohammad": 10, "moistur": 67, "molina": 32, "mom1": 87, "mom1initial_fil": 87, "mom2": [84, 87], "mom2initial_fil": [84, 87], "mom6": [8, 24], "moment": [11, 84], "momentum": 74, "mon": 46, "monclim": 47, "mondai": [6, 8, 32, 63], "monei": [29, 63], "monet": 24, "monitor": 25, "monkei": 83, "mont": 41, "month": [8, 16, 20, 30, 31, 39, 41, 46, 47, 59, 61, 65, 68, 80, 81, 88], "month_1": [20, 28, 39, 41, 61, 68, 80], "month_1cont": 61, "month_1model_doi_url": 39, "month_1time_constant_3dvars_filenam": 80, "month_1xarrai": 68, "month_length": 68, "month_numb": 41, "monthli": [6, 8, 32, 36, 38, 42, 46, 67, 68, 80, 86], "monthly_averag": 20, "monthly_obs_d": 41, "monthly_obs_plot": 41, "monthly_ocean_histori": 20, "monthly_ocean_timeseri": 20, "monthlyintake_esm_attr": 38, "monthlyxarrai": 38, "moor": 63, "more": [2, 4, 6, 7, 8, 10, 11, 12, 13, 15, 16, 17, 20, 24, 25, 28, 29, 32, 34, 37, 38, 39, 40, 41, 44, 45, 46, 47, 52, 57, 59, 60, 62, 63, 64, 65, 67, 68, 71, 74, 75, 80, 81, 84, 86, 87, 88, 90], "moreov": 2, "morn": [63, 76, 88], "most": [2, 4, 7, 8, 10, 25, 28, 30, 31, 32, 37, 48, 61, 62, 63, 68, 69, 74, 75, 79, 80, 89], "mostli": [12, 24, 63, 73, 88, 90], "motion": 63, "motiv": [8, 15, 25, 29, 40, 42, 44, 59, 63, 80], "mount": [12, 15], "mountain": [8, 16, 19, 21, 26, 27, 33, 34, 35, 40, 49, 54, 55, 56, 58, 60, 66, 70, 78, 82], "mous": [8, 74], "move": [7, 8, 12, 15, 19, 23, 24, 25, 26, 27, 29, 32, 40, 50, 55, 56, 61, 62, 63, 66, 67, 70, 74, 78, 79, 84], "movement": 25, "mozilla": 63, "mpa": [39, 90], "mpg": 87, "mph": 65, "mpi": 25, "mpimet": 87, "mpl": 80, "mpl2nc": 63, "mq0h46t1": 73, "mscur": 80, "msldescript": 67, "msr_x": 67, "mt": [6, 16, 32], "much": [2, 8, 10, 20, 25, 29, 45, 50, 52, 62, 63, 68, 69, 73, 83, 84, 87, 90], "mudryk": 38, "mudryknco_openmp_thread_numb": 38, "multi": [7, 8, 15, 16, 70], "multidimension": 23, "multimedia": 92, "multipl": [8, 16, 30, 39, 42, 51, 53, 62, 63, 65, 69, 82, 86, 87, 90], "multipli": [46, 61, 68, 73], "multizarr_profil": 84, "multizarrtozarr": [84, 86], "must": [1, 6, 8, 10, 13, 14, 15, 36, 52, 53, 61, 72, 80, 83], "muszala": 80, "mutablemap": 86, "mutat": 53, "my": [8, 11, 12, 15, 17, 45, 62, 63, 69, 71, 74, 86], "my_env": 45, "my_environ": 7, "my_usernam": 7, "myenv": 71, "myself": [8, 15, 62, 74, 90], "mzz": [84, 86], "n": [7, 11, 13, 23, 28, 37, 46, 47, 50, 61, 65, 67, 71, 72, 73, 80, 81, 83, 86], "n02_ctsm1": 80, "n2o": [72, 83, 84], "n2ovmr": [72, 83, 84], "n_": [72, 83], "n_a": [72, 83], "n_b": [72, 83], "n_job": [20, 28], "naiv": [73, 81], "name": [1, 7, 12, 13, 14, 15, 19, 20, 21, 23, 26, 27, 28, 33, 34, 35, 38, 39, 40, 41, 44, 45, 47, 49, 50, 51, 54, 55, 56, 57, 58, 60, 61, 64, 66, 67, 69, 70, 71, 72, 73, 74, 78, 80, 81, 82, 83, 84, 86, 87, 88], "nan": [7, 18, 36, 41, 46, 47, 61, 68, 80, 83], "nanarrai": [61, 80], "nandataset": 46, "nanlong_nam": [46, 61], "nanmax": 61, "nanmin": 61, "nanni": [37, 41, 62, 73, 86], "nano": 12, "nanr": [72, 83], "nanr_forkati": 83, "nanrhost": 72, "narr": [2, 8, 71], "narrai": 46, "nasa": 41, "nation": [8, 37, 56, 59, 61, 63], "nativ": [15, 25, 39, 53, 90], "natur": [10, 23, 47, 80], "nav": 88, "navbar": 88, "navig": [0, 1, 8, 11, 19, 21, 26, 27, 33, 34, 58, 59, 66, 75, 86, 88], "nbdate": [72, 83, 84], "nbedrock": 80, "nbf": 44, "nbformat": 44, "nbnd": [23, 38, 46, 51, 72, 83, 84], "nbound": 61, "nbsec": [72, 83, 84], "nbyte": 87, "nc": [7, 17, 20, 23, 28, 41, 43, 46, 47, 61, 65, 67, 72, 80, 81, 83, 84, 86, 87], "ncar": [0, 1, 2, 6, 8, 10, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 30, 32, 33, 34, 35, 36, 37, 38, 39, 40, 43, 46, 49, 50, 54, 55, 56, 58, 59, 60, 61, 62, 66, 67, 68, 70, 71, 72, 78, 82, 83, 84, 85, 86, 88, 90, 92, 93], "ncar_jobqueu": [8, 20, 22, 37, 38, 39, 41, 46, 47, 52, 61, 62, 67, 68, 83, 84], "ncar_pandas_tutori": 58, "ncarclust": [20, 37, 38, 39, 41, 46, 47, 52, 61, 62, 67, 68, 83, 84], "ncat": 17, "nccvs_revis": [72, 83], "ncdomain_b": [72, 83], "ncdump": 87, "ncei": 61, "nceisea_nam": 61, "ncep": 81, "ncgd0011": 87, "ncgrid_file_dst": [72, 83], "ncgrid_file_src": [72, 83], "ncgrid_til": 86, "ncinitial_conditions_dataset": 80, "ncinstitut": 17, "ncintake_esm_attr": 38, "nck": [17, 23, 41], "ncl": [24, 81, 93], "nclognam": [38, 84], "ncltype_vegetated_or_bare_soil": 80, "ncmodel_doi_url": [84, 87], "ncnaming_author": 61, "ncnco": [23, 41, 87], "nco": [23, 38, 41, 51, 83, 87, 90], "nco_openmp_thread_numb": 17, "ncol": [8, 23, 51, 72, 83], "ncpft_physiological_constants_dataset": 80, "ncpu": [22, 43, 46, 52, 87], "ncrcat": 87, "ncremap": [83, 90], "nctime_constant_3dvar": 80, "nctopography_fil": [23, 72, 83, 84, 87], "ncvi": 90, "nd": [28, 80], "ndarrai": [17, 28, 38, 39, 41, 46, 61, 67, 68, 72, 73, 80, 83, 84, 86, 87], "nday1": 20, "ndbase": [72, 83, 84], "ndcur": [72, 83, 84], "ndim": [80, 87], "ndimag": 63, "ne": [23, 51, 72, 83], "ne120": [72, 83], "ne120_g16": 83, "ne120_t12": [23, 51, 72], "ne120np4_l30_c110928": 83, "nearest": [37, 68, 90], "neccessari": [8, 23, 43, 44], "neccessarili": [20, 28, 46, 67, 84], "necessari": [0, 7, 8, 12, 14, 19, 21, 26, 27, 35, 40, 43, 45, 49, 54, 55, 56, 58, 66, 69, 70, 78, 86], "necessarili": 14, "nedit": 12, "need": [1, 2, 6, 7, 8, 10, 11, 12, 13, 14, 15, 16, 17, 20, 23, 24, 25, 28, 29, 31, 35, 37, 38, 42, 43, 45, 46, 50, 51, 52, 57, 61, 63, 65, 67, 68, 69, 71, 72, 73, 77, 79, 80, 81, 84, 85, 86, 87, 88, 90], "needleleaf_deciduous_boreal_tre": 80, "needleleaf_evergreen_boreal_tre": 80, "needleleaf_evergreen_temperate_tre": 80, "neeed": 12, "negin": [89, 92], "neglgibl": 81, "neighbor": [15, 90], "neither": [81, 87], "nesdi": 61, "nest": [67, 87], "net": [23, 36, 41, 63, 87], "netcdf": [7, 8, 20, 23, 25, 28, 29, 32, 37, 39, 41, 46, 51, 61, 63, 65, 68, 83, 86, 87], "netcdf3": 86, "netcdf3tozarr": 86, "netcdf4": [8, 65, 67, 84], "network": [2, 36, 63, 73], "never": [11, 13, 15], "new": [0, 2, 4, 6, 8, 10, 11, 12, 15, 18, 25, 28, 29, 30, 31, 32, 35, 36, 39, 43, 45, 50, 53, 55, 67, 70, 71, 72, 73, 74, 78, 80, 84, 86, 92], "new_d": 17, "new_notebook": 44, "new_tim": 65, "newest": [8, 52], "newref": 86, "next": [4, 8, 11, 12, 13, 16, 19, 20, 21, 24, 26, 27, 33, 34, 35, 39, 40, 45, 47, 49, 50, 54, 55, 56, 57, 58, 59, 60, 62, 63, 66, 67, 68, 70, 72, 78, 79, 82, 88], "nh4": 44, "nhug": 6, "nice": [14, 15, 72, 80, 90], "nicer": 39, "nichola": 89, "nick": [76, 92], "night": [8, 15], "nihanth": 92, "njob": [20, 28, 41], "nlat": [20, 28, 39, 47, 61, 68], "nlat_b": 61, "nlcd": 67, "nlon": [20, 28, 39, 47, 61, 68], "nlon_b": 61, "nlong_nam": 86, "nlonxarrai": 68, "nnz": [80, 83], "nnz104414density0": 80, "nnz2654208density3": 83, "nnz3density0": 80, "nnz417656density0": 80, "nnzval": 83, "no3": 44, "no_convert": 44, "noaa": [46, 61, 63, 81], "noah": 67, "nobodi": 90, "nodc": 61, "nodc_netcdf_grid_template_v2": 61, "nodc_template_vers": 61, "node": [1, 8, 25, 30, 36, 38, 43, 50, 68, 71, 84, 87], "nodefault": 7, "nodej": 45, "noleap": [11, 41, 61, 72, 83, 84, 86, 87], "noleapcartesian_axi": 86, "nomin": 86, "non": [11, 12, 25, 53, 63, 67, 80, 84, 87], "non_vertical_dim": 47, "none": [14, 17, 20, 28, 39, 46, 61, 65, 80, 81, 86, 87], "nonearrai": 86, "nonedescript": 67, "noneintake_esm_dataset_kei": 46, "nonelong_nam": 86, "nonemodel_doi_url": 61, "nonetime_period_freq": 39, "noon": [8, 91], "nor": 87, "normal": [72, 83, 87], "north": [41, 48, 67, 86], "north_grid_dimens": 67, "north_patch_end_stag": 67, "north_patch_end_unstag": 67, "north_patch_start_stag": 67, "north_patch_start_unstag": 67, "northeast": 61, "northunit": 86, "northwest": 61, "not_veget": 80, "notabl": 2, "notat": [13, 61], "note": [0, 1, 6, 8, 13, 14, 15, 20, 22, 25, 27, 28, 39, 40, 42, 46, 47, 61, 63, 72, 76, 80, 81, 83, 84, 86, 90, 93], "notebook": [0, 4, 6, 7, 8, 12, 18, 20, 21, 25, 39, 40, 43, 46, 48, 49, 50, 53, 54, 55, 57, 59, 60, 62, 63, 66, 67, 73, 75, 80, 82, 83, 86, 90, 92, 93], "notebook_nam": 44, "notic": [8, 13, 15, 16, 23, 28, 38, 41, 42, 43, 44, 46, 51, 61, 65, 67, 68, 71, 74, 79, 80, 81, 87, 90], "notimplementederror": 80, "nov": [72, 86], "novel": 2, "novemb": [8, 16, 56, 75, 76, 77], "now": [6, 7, 8, 15, 17, 18, 22, 23, 25, 28, 31, 32, 37, 38, 39, 41, 42, 43, 46, 47, 50, 51, 57, 61, 63, 65, 67, 68, 71, 72, 73, 74, 79, 80, 81, 83, 84, 86, 87, 89], "nowher": 15, "np": [17, 23, 28, 38, 39, 41, 43, 46, 47, 51, 61, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "npartit": 86, "npft": 80, "npm": 1, "nsbase": [72, 83, 84], "nscur": [72, 83, 84], "nsf": [2, 6, 8, 92, 93], "nstep": 80, "nsteph": [72, 83, 84], "nt": 73, "ntrk": [46, 72, 83], "ntrm": [46, 72, 83], "ntrn": [46, 72, 83], "nuanc": 4, "null": 86, "num_metgrid_level": 67, "num_nod": [36, 50], "num_sm_lay": 67, "num_st_lay": 67, "num_year": 20, "number": [7, 8, 15, 17, 20, 22, 23, 28, 31, 36, 37, 41, 42, 43, 47, 50, 52, 53, 61, 63, 65, 68, 73, 80, 81, 86, 87, 88], "number_of_observationslong_nam": 61, "numberunit": 86, "numer": [8, 14, 20, 29, 37, 53, 59, 62, 68], "numfocu": 63, "numpi": [7, 8, 17, 23, 38, 39, 41, 43, 45, 46, 47, 49, 60, 61, 63, 67, 68, 70, 72, 73, 75, 76, 77, 80, 81, 83, 84, 86, 87], "nurtur": 78, "nv": 86, "nv_a": [72, 83], "nv_b": [72, 83], "nvap_03_climo": 41, "nvpandasindexpandasindex": 86, "nwj08h26": 41, "nx": 73, "ny": 73, "o": [10, 43, 44, 47, 61, 84, 87], "o2": 44, "o3": 41, "o_o": 80, "oa1": 67, "oa1l": 67, "oa1ss": 67, "oa2": 67, "oa2l": 67, "oa2ss": 67, "oa3": 67, "oa3l": 67, "oa3ss": 67, "oa4": 67, "oa4l": 67, "oa4ss": 67, "ob": [46, 61, 68, 84], "obj": 42, "object": [7, 8, 11, 12, 13, 17, 18, 22, 23, 24, 25, 28, 36, 37, 38, 39, 41, 46, 50, 51, 53, 60, 61, 63, 64, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "object0021": 23, "object0024": 61, "object0046": 86, "object1700": 80, "object1850": 46, "object1860": 41, "object1920": 72, "object1970": 84, "object1980": 17, "object2000": [83, 87], "object2006": 38, "object2015": 68, "objectdask": [38, 68, 72, 80, 83, 84, 86, 87], "obs_": 46, "obs_catalog": 41, "obs_catalog_subset": 41, "obs_d": 61, "obs_data": [8, 41], "obs_df": 46, "obs_sum": [46, 68], "obsdataurl": 46, "observ": [8, 24, 32, 40, 63, 65], "observationvalid_rang": 46, "obtain": [15, 46], "obviou": 81, "obvious": [13, 15, 24], "oc": [47, 86], "oc5": 61, "occupi": 14, "occur": [11, 15], "occurr": [11, 15], "ocean": [8, 18, 24, 28, 39, 42, 43, 63, 68, 80, 82, 86], "ocean_mass_x_transporttime_avg_info": 86, "ocean_mass_y_transporttime_avg_info": 86, "ocean_mixed_layer_thickness_defined_by_sigma_ttime_avg_info": 86, "ocean_tim": 73, "ocean_timexarrai": 73, "ocean_volumetime_avg_info": 86, "oceanograph": [23, 70], "ocn": [20, 28, 36, 39, 43, 44, 61, 68, 86], "octob": [8, 10, 16, 19, 30, 46, 63], "odd": [15, 61], "off": [8, 15, 16, 37, 42, 50, 68, 82, 92], "offer": [8, 16, 29, 32, 36, 38, 44, 62, 63], "offic": [2, 7, 8, 10, 23, 74, 92], "offici": [28, 50, 57, 65], "offlin": [72, 83], "often": [1, 8, 28, 38, 59, 61, 62, 64, 69, 74, 80, 87], "oftentim": 74, "oi": 81, "oil": 15, "oilpalm": 80, "oisst": 63, "ok": [61, 73], "okai": [25, 74], "ol1": 67, "ol1l": 67, "ol1ss": 67, "ol2": 67, "ol2l": 67, "ol2ss": 67, "ol3": 67, "ol3l": 67, "ol3ss": 67, "ol4": 67, "ol4l": 67, "ol4ss": 67, "older": [24, 81], "omip": 42, "omip1": 42, "omit": 12, "oml": 86, "omon": 42, "onc": [0, 12, 20, 23, 28, 36, 40, 41, 50, 52, 57, 59, 62, 63, 64, 67, 71, 75, 80, 86, 90], "one": [7, 8, 11, 12, 13, 16, 17, 24, 28, 29, 31, 32, 35, 36, 39, 41, 43, 44, 45, 46, 49, 50, 51, 54, 57, 59, 61, 62, 63, 64, 67, 68, 71, 72, 73, 74, 76, 78, 79, 80, 81, 85, 86, 87, 88, 90, 91, 93], "ones": [46, 68], "ones_out": [46, 68], "ones_sum": 68, "ongo": [32, 90, 93], "onli": [0, 7, 8, 10, 12, 13, 15, 18, 20, 25, 28, 38, 39, 41, 43, 44, 45, 46, 51, 53, 61, 63, 64, 67, 69, 72, 73, 80, 83, 84, 87, 88, 90], "onlin": [8, 10, 15, 18, 50, 62, 77, 89, 92], "online1": [23, 51], "onlytruesize14": 80, "onlytruesize2": 80, "onlytruesize3": 80, "onlytruesize48storag": 80, "onlytruesize50": 83, "onlytruesize60storag": 80, "onlytruesize72storag": 80, "onto": [22, 39, 60], "oop": 87, "oop_hrrr_tutori": [8, 55], "oop_tutori": 55, "open": [0, 1, 2, 6, 7, 8, 10, 12, 23, 24, 25, 29, 30, 36, 41, 42, 44, 45, 50, 56, 57, 59, 64, 67, 70, 76, 78, 82, 84, 86, 88, 90, 92], "open_dataset": [7, 8, 11, 17, 23, 41, 46, 47, 61, 65, 67, 72, 80, 81, 83, 84, 87], "open_datatre": 86, "open_esm_datastor": [20, 28, 36, 37, 38, 39, 41, 42, 43, 46, 50, 61], "open_mfdataset": [7, 8, 17, 65, 67, 84, 86, 87], "open_zarr": [61, 68, 86], "opendap": [8, 37], "openli": [57, 61], "oper": [6, 7, 11, 14, 16, 20, 23, 25, 39, 51, 62, 63, 83, 87, 93], "opportun": [2, 8, 25, 43, 62, 63, 89, 90], "opportunti": 39, "oppos": [8, 12, 39], "opt": [22, 23, 39, 43, 46, 52, 61, 65, 71, 83, 87], "optic": 72, "optim": [8, 25, 31, 41, 47, 62], "optimum": [63, 81], "option": [1, 7, 8, 11, 12, 20, 23, 28, 31, 37, 39, 41, 42, 45, 47, 50, 51, 57, 62, 64, 67, 83, 88, 91, 93], "orang": [7, 43], "order": [8, 10, 11, 13, 14, 28, 29, 30, 38, 43, 47, 48, 63, 68, 83, 85, 86, 87, 91], "ordered_dsets_kei": 43, "org": [18, 28, 39, 59, 61, 63, 68, 69, 80, 84, 87], "organ": [2, 7, 8, 10, 12, 25, 40, 59, 63, 70, 76, 78, 89, 90], "orhan": [2, 30, 32, 76, 77, 92], "orient": [2, 8, 36, 44, 50, 60, 74, 80, 81], "origin": [0, 15, 18, 29, 39, 44, 46, 61, 71, 73, 83, 86], "orograph": 67, "orographi": 67, "orographystagg": 67, "orthogon": 87, "oss": 63, "other": [0, 6, 7, 8, 12, 14, 15, 16, 20, 24, 25, 28, 29, 38, 39, 41, 44, 46, 47, 50, 51, 53, 57, 59, 62, 63, 64, 68, 70, 71, 73, 78, 79, 80, 82, 83, 86, 87, 88, 93], "otherwis": [45, 86], "ouch": 73, "ouput": 18, "our": [2, 7, 8, 10, 13, 14, 15, 16, 17, 18, 20, 25, 28, 29, 30, 31, 32, 35, 36, 40, 41, 43, 51, 59, 61, 62, 63, 67, 68, 69, 73, 77, 80, 81, 82, 84, 85, 87, 88, 89, 90, 92], "ourselv": 7, "out": [6, 7, 8, 10, 11, 12, 15, 16, 23, 24, 25, 28, 29, 30, 31, 32, 36, 37, 38, 39, 43, 44, 45, 50, 57, 59, 62, 63, 64, 65, 67, 68, 71, 73, 74, 75, 78, 79, 80, 81, 83, 85, 86, 88, 90], "out_lat": 61, "out_lon": 61, "out_notebook_nam": 44, "out_shap": [61, 72, 83], "outf": 84, "outfil": 12, "outlin": [3, 32, 59, 61, 77], "output": [8, 15, 18, 23, 24, 25, 28, 30, 31, 32, 36, 37, 43, 44, 51, 61, 62, 71, 72, 73, 81, 87, 90, 93], "output_core_dim": 80, "output_dtyp": 80, "output_s": [61, 80], "outputsunit": 72, "outputunit": 72, "outsid": [8, 15, 23, 24, 25, 29, 89], "over": [6, 7, 8, 12, 13, 14, 20, 23, 37, 39, 41, 42, 43, 44, 45, 46, 47, 48, 50, 60, 61, 62, 63, 67, 68, 74, 75, 77, 80, 81, 83, 86, 87, 88], "overal": [24, 52, 88, 90], "overburden": 88, "overcom": [8, 74, 88], "overflow": [45, 74], "overhead": 62, "overlap": [8, 90], "overrid": [7, 20, 28, 41, 43, 61, 84, 87], "overtaken": 63, "overview": [6, 8, 28, 64, 88], "overwhelm": 42, "overwrit": 14, "own": [6, 7, 8, 11, 15, 16, 17, 24, 25, 29, 45, 50, 59, 62, 71, 74, 75, 76, 90], "oxygen": [25, 32], "p": [8, 18, 38, 41, 46, 47, 48, 50, 61, 63, 71, 72, 73, 80, 81, 83, 84, 90], "p0": [38, 41, 46, 72, 83, 84, 87], "p01mgeospatial_lat_min": 61, "p3jqok8h": 73, "p63ytime_coverage_resolut": 61, "pa": [72, 83, 84], "paarrai": 46, "pacakg": 7, "pacif": 81, "pack": [57, 63], "packag": [6, 7, 8, 12, 14, 16, 18, 21, 22, 23, 25, 26, 27, 28, 35, 36, 37, 38, 41, 42, 44, 45, 47, 49, 52, 53, 54, 55, 57, 58, 60, 61, 63, 66, 67, 68, 70, 71, 72, 74, 77, 80, 82, 83, 84, 85, 86, 87, 93], "package_nam": 7, "packagehistori": 41, "pad": [31, 48], "padescript": 67, "page": [6, 8, 15, 28, 30, 31, 32, 37, 39, 44, 59, 79, 88, 93], "pai": [15, 73], "pain": [8, 11, 25, 29, 31, 86], "pair": [8, 29, 32, 71], "palm": 15, "pan": 39, "panda": [8, 11, 18, 20, 23, 25, 41, 42, 43, 46, 59, 63, 65, 68, 74], "pane": [18, 39], "panel": [0, 18, 39], "panelifi": 18, "pangeo": [2, 4, 7, 8, 10, 11, 29, 30, 31, 32, 46, 63, 70, 72, 82, 83], "paper": [2, 8, 25, 46, 63, 64, 71], "papermil": [8, 44], "papermill_runn": 71, "paradigm": [2, 10], "parallel": [8, 10, 20, 24, 28, 32, 47, 62, 67, 71, 72, 73, 80, 84, 86, 87], "param": [71, 84], "paramdata": 80, "paramet": [23, 28, 41, 44, 46, 47, 51, 52, 61, 67, 71, 72, 80, 83, 86], "parameter": 71, "parameteriz": 44, "parameterstagg": 67, "parametr": 71, "parasol": 72, "parellel": [8, 62], "parent": [12, 36, 86], "parent_stat": 81, "parenthes": 50, "parenthesi": 45, "pars": [20, 28, 40, 67, 90, 93], "parse_amwg_ob": 41, "parse_cesm_histori": 28, "parser": 28, "parsing_func": 28, "parsing_func_kwarg": 28, "part": [8, 10, 12, 15, 16, 22, 23, 25, 26, 27, 28, 38, 40, 44, 50, 51, 61, 63, 66, 82, 88], "parti": 16, "particip": [2, 8, 16, 63, 76, 77, 85, 90, 91, 92], "particul": 7, "particular": [2, 15, 23, 38, 80, 83, 86, 92], "particularli": [62, 73, 83], "partit": 62, "partner": [8, 32, 93], "partnership": [2, 8, 63, 90], "pass": [13, 28, 37, 41, 42, 61, 65, 67, 68, 74, 80], "passion": [8, 25, 56, 74, 78], "password": [7, 40, 57], "past": [7, 8, 12, 19, 21, 43, 49, 50, 58, 66, 71, 80], "patch": 83, "path": [8, 17, 20, 28, 36, 37, 38, 39, 41, 42, 45, 46, 57, 61, 63, 72, 83, 84, 86, 87], "path_column": 18, "path_column_nam": [20, 28, 41], "pathlib": [41, 86], "pathnam": 87, "patient": [74, 79], "pattern": [28, 61, 63, 87], "paul": [2, 8, 31, 35, 56, 76], "paver": 61, "payment": 15, "pb": [8, 32, 43, 52, 63, 87], "pbs_jobid": 87, "pbscluster": [8, 22, 37, 38, 41, 43, 46, 52, 61, 62, 67, 68, 83, 84, 87], "pco2surf": 28, "pcolor": 68, "pcolormesh": 68, "pd": [18, 20, 23, 41, 46, 65], "pdf": [48, 50, 59], "peaceiri": 44, "peak": 65, "pears": 92, "peer": 74, "pelican": 92, "pend": 7, "peopl": [8, 15, 24, 25, 29, 57, 62, 63, 68, 74, 79, 80, 83, 88, 89, 90], "per": [48, 62, 63, 67, 83, 86, 87, 88], "percent": [39, 67], "percentag": 67, "percentagestagg": 67, "percentdescript": 67, "percentil": 63, "percentstagg": 67, "perceptu": [8, 48], "perform": [7, 8, 10, 24, 32, 39, 43, 47, 51, 67, 73, 78, 84], "performance_report": [17, 20], "performancewarn": 67, "perhap": [38, 49, 68, 84, 87, 90], "period": [7, 20, 37, 44, 46, 61, 63, 72, 83, 86], "perman": 64, "permiss": [57, 88], "persever": 74, "persist": [25, 39, 47], "person": [6, 7, 8, 10, 15, 16, 49, 62, 63, 75, 77, 85, 88, 90], "perspect": [8, 74], "petabyt": 46, "peterson": [8, 76, 85, 91, 92], "pfc": [23, 72, 83], "pft": 80, "pft_constant": 80, "pftflag_valu": 80, "pftformatcoodata": 80, "pftmask": 80, "pftname": 80, "pfts1d_activ": 80, "pfts1d_ci": 80, "pfts1d_gi": 80, "pfts1d_itype_col": 80, "pfts1d_itype_lunit": 80, "pfts1d_itype_veg": 80, "pfts1d_ixi": 80, "pfts1d_jxy": 80, "pfts1d_lat": 80, "pfts1d_li": 80, "pfts1d_lon": 80, "pfts1d_wtcol": 80, "pfts1d_wtgcell": 80, "pfts1d_wtlunit": 80, "pftxarrai": 80, "pg2oop": 56, "phenomena": 63, "philanthropi": 63, "philip": [76, 77, 92], "photo": 88, "photoc_diat_zint": 44, "photoc_diaz_zint": 44, "photoc_sp_zint": 44, "photoc_tot_zint": 44, "photosynthesi": 80, "physic": [8, 37, 44, 45, 67, 70, 90], "physicist": 56, "physics_": 44, "physics_salt": 44, "pi": [63, 73], "pick": [7, 11, 12, 87], "picontrol": [84, 87], "pictur": [24, 65], "piec": [8, 11, 28, 39, 62, 64], "pilot": 91, "pilotchut": [33, 55], "pin": 25, "ping": 88, "pint": [25, 80], "pip": [7, 15, 28, 38, 44, 50, 67, 69], "pipelin": [23, 31, 63], "pitch": [8, 10], "pjk": 38, "place": [4, 6, 7, 8, 15, 24, 32, 39, 42, 44, 50, 59, 62, 63, 69, 71, 80, 83, 86, 93], "placehold": 15, "plaform": [8, 57], "plai": 63, "plan": [8, 10, 24, 28, 29, 63, 71, 77], "plant": 80, "platecarre": [23, 80, 81], "platform": [7, 11, 24, 29, 31, 37, 46], "playist": 92, "pleas": [6, 8, 12, 16, 19, 21, 26, 27, 33, 34, 35, 38, 40, 49, 54, 55, 56, 58, 61, 66, 70, 75, 77, 78, 79, 82, 84, 85, 87, 88], "plenari": 76, "plenti": 90, "plev": 67, "plot": [8, 28, 30, 32, 33, 47, 48, 60, 63, 68, 71, 72, 73, 83, 87, 93], "plot_comparison": 39, "plot_field": 68, "plot_interact": 39, "plot_typ": 18, "plottl": 19, "plt": [30, 37, 39, 41, 43, 47, 48, 72, 73, 80, 81], "plu": [86, 90], "plug": [8, 80], "plugin": [25, 64, 93], "pm": [8, 16, 19, 21, 26, 27, 32, 33, 34, 35, 40, 44, 49, 54, 55, 56, 58, 60, 66, 70, 71, 78, 82], "pmsl": 67, "pn": [18, 39], "png": [8, 18, 39, 48, 50, 72, 73, 80], "png_catalog": 18, "po4": 44, "poc_flux_100m": 44, "pod": 44, "point": [1, 8, 11, 12, 15, 17, 23, 24, 25, 29, 30, 31, 32, 36, 42, 43, 44, 46, 47, 50, 57, 61, 63, 67, 71, 74, 80, 81, 83, 86, 87], "pointer": [12, 13], "pointinterp_method": 86, "pointlong_nam": 86, "pointstandard_nam": 46, "pointsunit": 86, "polit": 87, "polyfit_coeffici": 73, "polygon": 83, "polynomi": 73, "pop": [7, 8, 18, 20, 24, 28, 39, 43, 47, 61], "pop2": [28, 39, 61, 68, 93], "pop_grid": 61, "pop_gx1v7": 47, "pop_item": 46, "pop_tool": [43, 47, 61], "popitem": 46, "popular": [8, 15, 63, 64], "port": [22, 24, 38, 43, 52, 68, 84, 87], "portabl": 31, "portal": [8, 32, 88], "portion": [8, 22, 42, 47, 63, 84], "posit": [30, 38, 46, 61, 84], "posix": 84, "posixpath": [20, 28], "possibl": [1, 7, 24, 45, 53, 57, 67, 73, 80, 86, 87], "post": [0, 1, 6, 7, 11, 17, 25, 28, 29, 39, 40, 42, 43, 44, 45, 47, 50, 51, 52, 61, 63, 65, 67, 68, 71, 73, 75, 76, 77, 81, 83, 84, 88, 92], "postag": 15, "postdoc": 63, "poster": 8, "postprocess": 24, "potato": 80, "potenti": [2, 7, 28, 29, 37, 39, 42, 61, 68, 79, 80, 86], "power": [8, 23, 25, 28, 32, 37, 39, 43, 57, 83, 86], "pr": [0, 6], "practic": [2, 6, 7, 8, 10, 12, 13, 14, 29, 45, 64, 74, 76, 86, 87, 91], "pre": [0, 8, 37, 41, 44, 61, 65, 67, 72, 83, 86], "prec": 87, "preced": [13, 90], "precip": 63, "precipit": 87, "precis": 81, "precl_07_climo": 41, "prect": 87, "predict": [30, 31], "prefer": [1, 7, 11, 12, 29, 57, 75], "prefix": 17, "preliminari": 80, "prem": 92, "premis": 91, "prep": 75, "prepar": [6, 8, 77, 88, 90], "prepend": 45, "prepocess": 25, "preprint": 25, "preprocess": [8, 23, 31, 32, 61, 63, 65, 67], "prerequisit": 59, "presenc": [8, 89], "present": [6, 7, 8, 24, 25, 59, 62, 63, 73, 78, 80, 89, 90], "presentdai": 47, "preserv": [80, 90], "pressur": [37, 48, 67], "pressurearrai": 41, "pressurestagg": 67, "pressureunit": [46, 72, 83, 84], "pretti": [11, 61, 73, 84], "prev_avg_period": 81, "prevent": [29, 37, 61], "preview": [1, 68], "previou": [6, 8, 13, 14, 18, 19, 20, 25, 26, 27, 29, 35, 39, 41, 46, 49, 50, 52, 54, 57, 61, 68, 73, 75, 79, 80, 84, 88], "previous": [28, 32, 39, 47, 57, 67, 68, 84], "primari": [2, 6, 8, 23, 44, 59, 63, 72, 80, 86], "primarili": [2, 8, 40, 44, 49, 63, 67], "primit": 68, "principl": [2, 23], "print": [8, 13, 15, 17, 18, 20, 23, 37, 39, 43, 44, 67, 68, 72, 80, 83, 84, 86], "prior": [8, 15, 40, 73, 85, 87, 89, 91], "priorit": 63, "prison": 15, "privat": [6, 63], "pro": [8, 12, 22], "proactiv": 2, "probabl": [73, 83], "problem": [2, 8, 10, 11, 14, 17, 24, 42, 63, 73, 75, 80, 86], "problemat": [25, 42, 73], "proc": [7, 20, 72], "proce": [39, 73], "proceed": [8, 89], "process": [7, 8, 17, 22, 23, 29, 30, 31, 32, 36, 38, 41, 43, 44, 46, 47, 52, 57, 61, 62, 67, 73, 74, 80, 81, 83, 84, 86, 87, 90, 91], "processedkeyword": 61, "processor": [62, 74, 84, 86], "produc": [2, 12, 17, 23, 37, 53, 64, 67, 71, 83, 84, 93], "product": [2, 6, 7, 8, 17, 25, 50, 80, 83], "productionunit": 80, "profess": 78, "profession": 63, "profil": [47, 61, 63], "profit": 63, "profoundli": 2, "prognost": [28, 39, 61, 68], "program": [2, 7, 8, 10, 16, 24, 29, 40, 60, 63, 74, 78, 82], "progress": [6, 8, 30, 59, 62, 67], "progressbar": 20, "project": [2, 4, 7, 8, 11, 22, 23, 24, 25, 30, 37, 38, 40, 41, 42, 43, 44, 47, 50, 52, 63, 69, 70, 71, 75, 77, 78, 80, 81, 82, 83, 84, 86, 87, 90, 91], "project_id": [22, 43, 52], "project_numb": 47, "projectid": 61, "projectprocessing_level": 61, "projectpythia": 59, "projectpythiatutori": [40, 70, 78], "promis": 25, "promot": [2, 6, 10, 25, 29], "prompt": [0, 12, 24, 45], "proof": 67, "propag": 83, "proper": [7, 68, 72], "properli": [8, 12, 39, 62, 67, 71, 73, 87], "properti": [63, 71], "propos": [6, 29, 67, 77, 85, 87, 88], "protocol": [63, 80, 86], "prototyp": [8, 10, 28, 30, 31, 32, 38, 44, 80], "prove": [8, 11], "proven": [2, 24], "provid": [2, 6, 7, 8, 10, 20, 23, 24, 25, 29, 30, 31, 36, 44, 48, 50, 52, 53, 59, 62, 64, 67, 68, 72, 73, 77, 80, 81, 83, 84, 86, 87, 88, 92, 93], "proxi": [22, 37, 38, 41, 43, 46, 52, 61, 62, 67, 68, 83, 84, 86, 87], "prun": 84, "prune": 45, "psarrai": [41, 72, 83, 84], "psd": 46, "pseudocod": [8, 87], "psfc": 67, "psl": [46, 51], "pslong_nam": [38, 46, 84], "psn012": 51, "psn012version": 23, "psu": 86, "pt": 23, "public": [7, 8, 37, 59, 61, 63, 64], "publicli": [8, 65, 89], "publish": [6, 8, 32, 50, 63, 64, 69, 89], "publish_dir": 44, "publisher_email": 61, "publisher_institut": 61, "pull": [0, 8, 19, 26, 27, 35, 39, 50, 63, 65, 81, 90], "puls": 80, "pump": [86, 87], "punctuat": 15, "pure": [14, 80], "purpos": [8, 10, 15, 17, 35, 38, 47, 71, 81, 83, 86, 88, 90], "pursu": [40, 80], "pursuit": [8, 88], "push": [0, 25, 29, 30, 35, 44, 63], "put": [4, 8, 15, 24, 39, 42, 45, 46, 47, 62, 64, 73, 74, 93], "puzzl": 74, "py": [8, 20, 28, 37, 38, 41, 44, 61, 67, 68, 69, 71, 80, 84, 87], "pyart": 63, "pydata": [39, 80, 83], "pypi": [28, 69], "pypii": 69, "pyplot": [37, 39, 41, 43, 47, 72, 73, 80, 81], "pyrom": 24, "pythia": [8, 29, 31, 32, 40, 65, 70, 75, 78, 82, 84, 86], "python": [1, 4, 6, 7, 8, 10, 15, 16, 19, 21, 23, 24, 25, 26, 27, 28, 33, 34, 35, 39, 40, 44, 45, 48, 49, 50, 53, 54, 55, 56, 58, 59, 63, 66, 67, 70, 75, 76, 77, 78, 84, 85, 86, 88, 89, 90, 91, 92], "python3": [15, 28, 37, 38, 41, 44, 61, 67, 68, 71, 80, 84, 87], "python_tutori": 12, "pyton": 60, "pyviz": 20, "q": [8, 12, 13, 14, 45, 48, 53, 69, 77, 86], "q_pbuh7n": 86, "qc": 63, "qqqqqqqaqd9vvvvvvubaqaaaaaaaaebavvvvvvvaqecqqqqqqqbaqqaaaaaaaebbvvvvvvvaqegqqqqqqqbaqgaaaaaaaebcvvvvvvvaqekqqqqqqqbaqwaaaaaaaebdvvvvvvvaqeoqqqqqqqbaraaaaaaaaebevvvvvvvaqesqqqqqqqbarqaaaaaaaebfvvvvvvvaqewqqqqqqqbargaaaaaaaebgvvvvvvvaqeaqqqqqqqbarwaaaaaaaebhvvvvvvvaqeeqqqqqqqbasaaaaaaaaebivvvvvvvaqeiqqqqqqqbasqaaaaaaaebjvvvvvvvaqemqqqqqqqbasgaaaaaaaebkvvvvvvvaqeqqqqqqqqbaswaaaaaaaeblvvvvvvvaqeuqqqqqqqbataaaaaaaaebmvvvvvvvaqeyqqqqqqqbatqaaaaaaaebnvvvvvvvaqe2qqqqqqqbatgaaaaaaaebovvvvvvvaqe6qqqqqqqbatwaaaaaaaebpvvvvvvvaq": 86, "qqqqqqqbauaaaaaaaaebqkqqqqqqgqfbvvvvvvvbauiaaaaaaaebqqqqqqqqgqfdvvvvvvvbauqaaaaaaaebrkqqqqqqgqffvvvvvvvbauyaaaaaaaebrqqqqqqqgqfhvvvvvvvbaugaaaaaaaebskqqqqqqg": 86, "qqqqqqrdax4aaaaaaambfvvvvvvvgwf8qqqqqqrdaxwaaaaaaambe1vvvvvvgwf6qqqqqqrdaxoaaaaaaambevvvvvvvgwf4qqqqqqrdaxgaaaaaaambd1vvvvvvgwf2qqqqqqrdaxyaaaaaaambdvvvvvvvgwf0qqqqqqrdaxqaaaaaaambc1vvvvvvgwfyqqqqqqrdaxiaaaaaaambcvvvvvvvgwfwqqqqqqrdaxaaaaaaaambb1vvvvvvgwfuqqqqqqrdaw4aaaaaaambbvvvvvvvgwfsqqqqqqrdawwaaaaaaamba1vvvvvvgwfqqqqqqqrdawoaaaaaaambavvvvvvvgwfoqqqqqqrdawgaaaaaaambz1vvvvvvgwfmqqqqqqrdawyaaaaaaambzvvvvvvvgwfkqqqqqqrdawqaaaaaaamby1vvvvvvgwfiqqqqqqrdawiaaaaaaambyvvvvvvvgwfgqqqqqqrdawaaaaaaaambx1vvvvvvgwfeqqqqqqrdav4aaaaaaambxvvvvvvvgwfcqqqqqqrdavwaaaaaaambw1vvvvvvgwfaqqqqqqrdavoaaaaaaambwvvvvvvvgwfyqqqqqqrdavgaaaaaaambv1vvvvvvgwfwqqqqqqrdavyaaaaaaambvvvvvvvvgwfuqqqqqqrdavqaaaaaaambu1vvvvvvgwfsqqqqqqrdaviaaaaaaambuvvvvvvvgwfqqqqqqqrdavaaaaaaaambt1vvvvvvgwfoqqqqqqrdau4aaaaaaambtvvvvvvvgwfmqqqqqqrdauwaaaaaaambs1vvvvvvgwfkqqqqqqrdauoaaaaaaambsvvvvvvvgwfiqqqqqqrdaugaaaaaaambr1vvvvvvgwfgqqqqqqrdauyaaaaaaambrvvvvvvvgwfeqqqqqqrdauqaaaaaaambq1vvvvvvgwfcqqqqqqrdauiaaaaaaambqvvvvvvvgwfaqqqqqqrdauaaaaaaaambpqqqqqqrawe9vvvvvvwdatwaaaaaaamboqqqqqqrawe5vvvvvvwdatgaaaaaaambnqqqqqqrawe1vvvvvvwdatqaaaaaaambmqqqqqqrawexvvvvvvwdataaaaaaaamblqqqqqqrawetvvvvvvwdaswaaaaaaambkqqqqqqrawepvvvvvvwdasgaaaaaaambjqqqqqqrawelvvvvvvwdasqaaaaaaambiqqqqqqrawehvvvvvvwdasaaaaaaaambhqqqqqqrawedvvvvvvwdarwaaaaaaambgqqqqqqrawezvvvvvvwdargaaaaaaambfqqqqqqrawevvvvvvvwdarqaaaaaaambeqqqqqqrawervvvvvvwdaraaaaaaaambdqqqqqqrawenvvvvvvwdaqwaaaaaaambcqqqqqqrawejvvvvvvwdaqgaaaaaaambbqqqqqqrawefvvvvvvwdaqqaaaaaaambaqqqqqqrawebvvvvvvwdaqaaaaaaaama": 86, "qssg0k7_": 41, "qstat": 7, "qsv6hesl": 41, "quadmesh": [38, 39, 41, 61, 67, 68, 80], "quadrilater": 68, "qualiti": [4, 6, 63], "quantifi": 63, "quantiti": [38, 44], "quarter": 81, "quartil": 63, "queri": [7, 28, 31, 42, 43, 46], "question": [6, 8, 10, 12, 13, 14, 23, 24, 25, 45, 48, 53, 62, 63, 64, 69, 72, 75, 76, 77, 79, 90], "queue": [7, 22, 43, 52, 87], "quick": [7, 20, 28, 29, 68, 90], "quickli": [8, 12, 23, 28, 46, 81, 88], "quickstart": 28, "quit": [8, 15, 23, 25, 39, 50, 61, 86, 87, 90], "quot": 17, "quotat": 45, "r": [38, 44, 45, 61, 63, 71], "r1002rbrxaaa01a": 17, "r1002rbrxaaa01aoutput_frequ": 17, "r10i1181p1f1": [46, 68], "r10i1231p1f1": [46, 68], "r10i1251p1f1": [46, 68], "r10i1281p1f1": [46, 68], "r10i1301p1f1": [46, 68], "r11i1231p1f2": 46, "r11i1281p1f2": 46, "r11i1301p1f2": 46, "r12i1231p1f2": 46, "r12i1281p1f2": 46, "r12i1301p1f2": 46, "r13i1231p1f2": 46, "r13i1251p1f2": 46, "r13i1281p1f2": 46, "r13i1301p1f2": 46, "r14i1231p1f2": 46, "r14i1251p1f2": 46, "r14i1281p1f2": 46, "r14i1301p1f2": 46, "r15i1231p1f2": 46, "r15i1251p1f2": 46, "r15i1281p1f2": 46, "r15i1301p1f2": 46, "r16i1231p1f2": 46, "r16i1281p1f2": 46, "r16i1301p1f2": 46, "r17i1231p1f2": 46, "r17i1281p1f2": 46, "r18i1231p1f2": 46, "r18i1251p1f2": 46, "r18i1281p1f2": 46, "r18i1301p1f2": 46, "r19i1231p1f2": 46, "r19i1251p1f2": 46, "r19i1281p1f2": 46, "r19i1301p1f2": 46, "r1i1001p1f1": [41, 46], "r1i1231p1f1": 46, "r1i1251p1f1": 46, "r1i1281p1f1": 46, "r1i1301p1f1": 46, "r20i1231p1f2": 46, "r20i1251p1f2": 46, "r20i1281p1f2": 46, "r20i1301p1f2": 46, "r2i1231p1f1": 46, "r2i1251p1f1": 46, "r2i1281p1f1": 46, "r2i1301p1f1": 46, "r3i1041p1f1": 46, "r3i1231p1f1": 46, "r3i1251p1f1": 46, "r3i1281p1f1": 46, "r3i1301p1f1": 46, "r4i1061p1f1": 46, "r4i1231p1f1": 46, "r4i1251p1f1": 46, "r4i1281p1f1": 46, "r4i1301p1f1": 46, "r5i1081p1f1": 46, "r5i1231p1f1": 46, "r5i1251p1f1": 46, "r5i1281p1f1": 46, "r5i1301p1f1": 46, "r6i1101p1f1": 46, "r6i1231p1f1": 46, "r6i1251p1f1": 46, "r6i1281p1f1": 46, "r6i1301p1f1": 46, "r7i1121p1f1": 46, "r7i1231p1f1": 46, "r7i1251p1f1": 46, "r7i1281p1f1": 46, "r7i1301p1f1": 46, "r8i1141p1f1": 46, "r8i1231p1f1": 46, "r8i1251p1f1": 46, "r8i1281p1f1": 46, "r8i1301p1f1": 46, "r9i1161p1f1": 46, "r9i1231p1f1": 46, "r9i1251p1f1": 46, "r9i1281p1f1": 46, "r9i1301p1f1": 46, "rabernat": 73, "racm": 17, "radar": [40, 72], "radi": [37, 41, 83], "radian": [72, 83], "radianc": 63, "radiat": 63, "radiomet": 63, "radiu": [61, 63], "raijin": [30, 90, 93], "raina": 65, "raina24": 65, "rais": [6, 7, 8, 23, 80, 84], "rajeev": 92, "ral": 2, "ram": 84, "rambl": [8, 15], "ran": [8, 42], "random": 73, "random_sampl": 73, "rang": [13, 20, 38, 41, 47, 53, 61, 63, 67, 68, 73, 81, 84, 86, 87], "rank": 10, "rankdir": [36, 50, 73], "rapese": 80, "rapid": 10, "rasm": [17, 71], "raster": [23, 38, 39, 41, 61, 67, 68], "rate": [2, 87], "rather": [23, 29, 43, 46, 47, 53, 67, 74], "ratio": [72, 83, 84], "ratio0": [80, 83], "ratio1": 80, "ravel": 80, "ravi": 25, "raw": [8, 18, 23, 36, 38, 45, 46, 50, 70], "raw_index": 25, "rb": [84, 86], "rcp": 38, "rcp8": 43, "rcp85": [36, 38, 43], "rcp85intake_esm_attr": 38, "rcparam": [68, 80], "rd": 23, "rda": [29, 81], "re": [7, 8, 12, 13, 14, 31, 45, 47, 74, 88], "reach": [8, 16, 62, 74, 75, 79, 88], "read": [8, 10, 12, 13, 15, 16, 17, 25, 29, 31, 32, 44, 47, 62, 63, 65, 78, 80, 82], "read_csv": 18, "read_xesmf_weights_fil": 83, "readabl": 65, "reader": 63, "readi": [0, 2, 6, 17, 40, 41, 49, 51, 71, 90], "readlin": [12, 13], "readm": [8, 33, 34, 50, 64, 75], "reagan": 61, "real": [25, 29, 80], "realist": 24, "realiti": 10, "realiz": [8, 15], "realli": [7, 8, 15, 25, 38, 63, 71, 73, 74, 80, 81, 87], "realm": 24, "reason": [14, 43, 44, 80, 86, 87], "recal": 80, "recap": [8, 83], "receiv": [8, 40, 45, 64, 73, 79, 80, 85, 88, 91], "recent": [2, 7, 15, 25, 28, 32, 52, 62, 80], "rechunk": [73, 87], "recip": [30, 31, 61], "recipi": 15, "recipient_address": 15, "recipient_compani": 15, "recipient_nam": 15, "recipient_titl": 15, "recogn": [2, 8, 29, 45, 80, 81], "recognit": [8, 64], "recommend": [6, 7, 12, 14, 35, 43, 62, 64, 87], "recomput": 61, "record": [8, 21, 33, 49, 53, 54, 55, 63, 77, 89, 92], "recreat": 7, "rectilinear": 72, "recurs": 28, "red": [46, 47, 65, 68], "red_white_blu": 61, "redo": [83, 90], "reduc": [7, 8, 37, 43, 61, 63, 68, 80, 84], "reduct": 23, "ref": 86, "refactor": [8, 69, 74], "refer": [6, 7, 13, 14, 23, 37, 41, 46, 59, 61, 72, 74, 83], "referec": 86, "referenc": 14, "reference_case_nam": 44, "reference_fil": 84, "refin": [2, 8, 72, 88], "reflect": [8, 61, 74, 88], "refocu": [8, 88], "refresh": 7, "refress": 34, "refs_stat": 86, "regard": [8, 23, 24, 39, 51, 67, 90], "regardless": [8, 15], "region": [24, 43, 63, 67], "regist": [8, 38, 77, 85, 91], "registr": [8, 77, 85], "regress": 73, "regrid": [8, 23, 32, 90], "regrid_cam_s": [72, 83], "regrid_method": [61, 72], "regridd": 61, "regridded_observ": 61, "regular": [6, 14, 28, 46, 71, 83, 84, 86, 88], "regulartitl": 86, "reimagin": [8, 32], "reinstal": [30, 75], "reinvent": 29, "rel": [8, 11, 20, 28, 67, 68, 80], "relabel": 39, "relampago": 40, "relat": [1, 2, 6, 7, 8, 19, 24, 25, 29, 32, 39, 41, 52, 59, 63, 65, 67, 79, 83, 90, 93], "relationship": 23, "relav": [8, 24], "releas": [8, 28, 38, 64, 68, 84, 87], "relev": [2, 6, 7, 8, 17, 28], "relhum": 41, "reli": 6, "relianc": 63, "remain": [2, 20, 28], "remap": [24, 72, 80, 90], "remap_cams": 83, "remapped_flat": 83, "remappingesmf_regrid_method": [72, 83], "remark": [8, 10], "rememb": [11, 20, 63, 74, 84], "remind": [8, 11, 72], "remot": [0, 8, 16, 18, 23, 25, 35, 46, 84], "remote_opt": 84, "remote_protocol": 84, "remov": [15, 45, 48, 61, 63, 72, 73, 74, 81, 83, 84, 87, 88], "rempl": 76, "renam": [46, 61, 67, 72, 83, 84, 86], "rend": [8, 39], "render": [2, 15, 18, 23, 39, 44, 50], "repeat": [11, 16, 80, 86, 90], "replac": [5, 7, 12, 15, 40, 44, 52, 57, 61, 83, 87], "replic": [8, 10, 46, 73, 93], "repo": [0, 8, 18, 32, 50, 63], "repo_root_directori": 44, "report": [20, 83], "repositori": [0, 1, 7, 8, 12, 18, 19, 21, 25, 26, 27, 28, 29, 30, 31, 33, 34, 35, 40, 43, 44, 49, 55, 56, 58, 61, 66, 70, 75, 78, 83, 91], "repository_nam": 50, "repr": [17, 72, 73], "repres": [1, 6, 15, 37, 61, 62, 80, 81, 83, 84, 86], "represent": [23, 80, 84, 86], "reproduc": [2, 6, 8, 10, 25, 29, 46, 61, 75], "reproduct": [8, 31], "reqard": [8, 82], "request": [0, 7, 8, 35, 61, 72, 86, 87, 90], "requir": [2, 7, 8, 20, 22, 23, 25, 28, 29, 36, 38, 44, 46, 50, 59, 61, 64, 67, 71, 72, 73, 80, 81], "resampl": [46, 68, 81], "research": [2, 4, 6, 7, 8, 23, 29, 30, 31, 37, 40, 41, 56, 59, 63, 67, 79, 88, 93], "reset_coord": 47, "reshap": [72, 73], "residu": 41, "resili": [62, 63], "resolut": [8, 23, 24, 32, 37, 39, 41, 48, 72, 81, 83], "resolv": [8, 23, 61, 75], "resort": 40, "resourc": [8, 10, 20, 22, 25, 29, 37, 42, 43, 45, 52, 61, 62, 63, 74, 78, 82, 84, 86, 87, 89, 90, 93], "resource_spec": [22, 43, 46, 52, 87], "respect": [2, 7, 32, 39, 44, 80, 84], "respond": 86, "respons": 61, "respositori": 28, "rest": [8, 10, 20, 24, 28, 67, 80, 88], "restart": [28, 45, 62], "restoa": 41, "restor": 83, "restratifi": 86, "restrict": 71, "result": [0, 8, 15, 17, 25, 28, 41, 43, 44, 51, 68, 71, 74, 80, 81, 87], "rethink": 63, "retri": [7, 84], "retriev": [11, 13, 35, 63], "return": [2, 8, 11, 12, 13, 14, 17, 20, 22, 23, 28, 38, 39, 41, 42, 43, 44, 46, 47, 51, 61, 65, 67, 68, 71, 72, 73, 74, 80, 83, 86, 87], "return_invers": 80, "reus": [71, 72, 83, 86], "reusabl": 2, "reuse_weight": [72, 83], "review": [0, 19, 33, 35, 75], "revis": [28, 39, 61, 68], "revision_id": [23, 51, 72, 83], "revolutionari": [8, 23], "rewritten": 73, "rh": [65, 67], "rho": 47, "rho_chunk": 47, "rho_in": 47, "rho_stack": 47, "rice": 80, "right": [0, 1, 7, 12, 14, 18, 20, 23, 36, 48, 50, 59, 68, 71, 72, 74, 80, 81, 83, 87, 88], "righttitl": 81, "righttitlefonts": 81, "risk": 63, "road": [28, 63], "roadblock": 74, "rob": 25, "robinson": [23, 41], "robust": [39, 80, 83], "rocki": [8, 65], "rodger": [8, 37], "rof": 28, "role": 63, "roll": [73, 74], "rom": 24, "romashkov": 2, "romashkova": [76, 77, 89], "romatschk": 2, "room": [8, 16, 24, 75, 77, 85, 90], "root": [8, 28, 44, 50, 74, 86], "root_path": [17, 20, 28], "rotat": 67, "roughli": [8, 61, 85, 91], "roundabout": 73, "routin": 15, "row": [13, 18, 20, 28, 36, 41, 46, 62, 72, 83, 84], "rse": 63, "rubber": 74, "rubi": 29, "rule": [7, 13, 87], "run": [5, 6, 7, 8, 12, 15, 17, 19, 20, 22, 24, 26, 27, 28, 29, 30, 33, 34, 37, 38, 39, 43, 44, 45, 46, 48, 50, 53, 55, 59, 62, 68, 69, 73, 75, 80, 83, 84, 86, 87, 91, 93], "runtimewarn": [11, 84], "rust": 25, "rw": 71, "ryan": [2, 32, 40, 89], "rye": 80, "s0_control": 80, "s19": 67, "s3": [8, 36, 46, 63, 68], "s3f": 84, "s3filesystem": 84, "s40": 80, "s40b": 80, "s8": [72, 83], "s8dask": [72, 83], "sadli": 73, "safe": 72, "safe_load": 44, "safest": 53, "sai": [7, 12, 13, 14, 88], "said": 15, "sake": 15, "salin": [39, 47], "salinitystandard_nam": 86, "salinityunit": 39, "salt": [36, 39, 44, 47], "same": [7, 8, 11, 12, 13, 14, 15, 17, 19, 23, 24, 26, 27, 38, 39, 46, 51, 52, 53, 57, 59, 63, 65, 68, 69, 71, 72, 79, 80, 86, 87, 90], "samp_sec": 65, "sampl": [8, 16, 28, 43, 65, 67, 71, 93], "sand": 67, "sandfrac": 67, "saniti": 24, "sat": [23, 87], "satellit": [25, 40], "satisfi": 80, "save": [6, 7, 12, 13, 17, 44, 45, 48, 57, 61, 71, 80, 88], "save_mfdataset": 7, "savefig": 48, "scalabl": [2, 20, 24, 25, 29], "scale": [2, 7, 8, 10, 20, 22, 23, 29, 32, 37, 38, 39, 41, 43, 46, 47, 52, 61, 63, 67, 68, 84, 87, 90, 92], "scam": 15, "scan": 63, "scare": 15, "scatter": [46, 65, 72], "scb_dom": 67, "scell_method": [80, 87], "scenario": [11, 15, 46], "schedul": [7, 8, 16, 17, 25, 31, 32, 37, 38, 41, 43, 46, 52, 61, 62, 67, 68, 73, 77, 79, 83, 84, 86, 87, 88], "scheick": 89, "scheme": 87, "schneck": 92, "school": 40, "scienc": [2, 3, 4, 6, 7, 10, 11, 23, 24, 25, 29, 40, 63, 73, 82, 88, 90, 92], "scientif": [2, 6, 7, 8, 10, 23, 24, 25, 29, 32, 50, 59, 62, 63, 81, 88, 90], "scientist": [2, 8, 10, 11, 16, 23, 29, 56, 59, 64, 70, 74, 79, 82, 88, 90], "scipi": [8, 23, 24, 32, 47, 51, 83], "scipy_kdtre": 51, "scope": [14, 25], "scott": [89, 92], "scratch": [4, 7, 10, 20, 23, 37, 38, 41, 43, 44, 67, 72, 80, 86, 87], "screen": [0, 12, 57], "screenshot": [44, 71, 73], "script": [7, 8, 12, 14, 15, 16, 22, 44, 82, 83, 93], "scroll": [23, 37, 59, 88], "sct_dom": 67, "se": [8, 51, 72, 90], "se_grid": 72, "sea": [37, 42, 48, 63, 67, 81, 86], "sea_floor_depth_below_geoid": 86, "sea_floor_depth_below_geoidunit": 86, "sea_surface_salinitytime_avg_info": 86, "sea_surface_temperatur": 81, "sea_surface_temperaturecell_method": 81, "sea_surface_temperaturetime_avg_info": 86, "sea_water_potential_temperaturetime_avg_info": 86, "sea_water_salinitytime_avg_info": 86, "sea_water_temp": 61, "sea_water_temperatur": 61, "sea_water_temperaturelong_nam": 61, "sea_water_x_velocitytime_avg_info": 86, "sea_water_y_velocitytime_avg_info": 86, "seaic": 67, "seam": 63, "seamless": [23, 39, 90], "search": [8, 15, 25, 28, 31, 36, 37, 38, 39, 41, 42, 46, 61, 73], "searchabl": 69, "season": [8, 16, 93], "seasonal_average_weighted_correctli": 81, "seasonal_average_weighted_incorrectli": 81, "seasonal_obs_d": 41, "seasonal_obs_plot": 41, "seasonpandasindexpandasindex": 81, "second": [8, 12, 13, 15, 23, 25, 30, 37, 47, 50, 65, 67, 72, 76, 80, 83, 84, 87, 90], "second_cas": 39, "second_plot": 39, "secret": 44, "section": [7, 8, 12, 13, 14, 20, 23, 30, 37, 40, 44, 59, 61, 63, 75, 76, 77, 80, 88], "secur": 79, "see": [0, 6, 7, 8, 10, 12, 13, 14, 15, 17, 20, 22, 25, 28, 29, 36, 37, 39, 41, 43, 44, 45, 46, 50, 51, 52, 57, 59, 62, 63, 67, 68, 69, 70, 71, 73, 74, 75, 77, 78, 80, 81, 83, 84, 85, 86, 87, 88, 89, 90], "seek": [2, 6, 78], "seem": [8, 39, 45, 51, 73, 83], "seemingli": 68, "seen": [38, 39, 63], "sehires38": [23, 51, 72], "seidov": 61, "seismic": 39, "sel": [7, 11, 37, 39, 46, 51, 61, 68, 80], "sel_drop": 30, "select": [6, 7, 8, 17, 22, 38, 41, 43, 46, 50, 51, 52, 57, 59, 71, 75, 79, 87, 88], "self": [20, 37, 41, 57, 67, 90], "selvar": 87, "selyear": 87, "semar": 16, "seminar": [8, 12, 13, 14, 19, 21, 26, 27, 33, 34, 35, 40, 45, 48, 49, 53, 54, 55, 56, 58, 66, 69, 70, 75, 77, 78, 85], "send": [6, 15, 28, 62], "sens": [8, 15, 23, 25, 31, 59, 88], "sensit": 13, "sent": 61, "sep": [20, 28, 39, 41, 61], "separ": [6, 14, 16, 41, 42, 46, 59, 86], "seper": [8, 69], "septemb": [8, 33, 34], "sequenc": 87, "sequenti": 80, "seri": [7, 8, 11, 12, 13, 14, 18, 19, 20, 21, 23, 26, 27, 28, 32, 33, 34, 35, 40, 45, 46, 48, 49, 53, 54, 55, 56, 58, 63, 66, 69, 70, 73, 78, 87, 92, 93], "serial": [7, 17, 25, 35, 71], "seriou": [15, 73], "serious": 11, "serv": [2, 4, 6, 8, 10, 24, 36, 64, 76, 78, 88], "servabl": 18, "server": [1, 7, 8, 18, 37, 38, 65, 68, 84, 87], "servic": [6, 8, 15, 45, 57, 63, 75, 79, 88, 92], "session": [8, 12, 13, 14, 16, 19, 21, 24, 26, 27, 34, 35, 40, 45, 48, 49, 53, 54, 55, 57, 58, 63, 66, 69, 76, 77, 82, 86, 90, 92], "set": [0, 2, 4, 6, 8, 12, 13, 15, 16, 20, 22, 23, 24, 28, 29, 31, 37, 38, 39, 41, 42, 47, 48, 51, 52, 57, 61, 62, 63, 67, 68, 74, 75, 77, 79, 80, 81, 84, 88], "set_axes_limits_and_tick": 81, "set_coord": 51, "set_index": 51, "set_opt": [39, 80], "set_tick": 81, "set_titles_and_label": 81, "set_xlim": 48, "setiawan": 89, "setlevel": 46, "setup": [7, 8, 12, 22, 28, 29, 37, 39, 42, 43, 44, 47, 50, 51, 62, 68, 71, 77], "setup_ax": 80, "sever": [2, 6, 7, 8, 11, 25, 36, 41, 59, 61, 93], "sewg": [8, 24], "sf": [23, 87], "sfcgroup": 86, "sfwf": 44, "sgyeager": [8, 42], "sh": 87, "shade": [62, 68], "shallowest": 80, "shape": [17, 30, 38, 39, 41, 46, 61, 63, 67, 68, 72, 73, 80, 83, 84, 86, 87], "shapew": 83, "sharabl": 61, "share": [2, 6, 8, 11, 12, 20, 24, 25, 28, 38, 44, 46, 48, 50, 63, 74, 76, 84, 87, 88, 89, 90, 92], "shareabl": 24, "she": [15, 67, 82], "sheet": 7, "shell": [12, 87], "shell_nam": 12, "shf": 44, "shf_qsw": 44, "shield": [64, 72], "shift": [8, 10], "shini": [8, 74], "ship": [59, 63], "shirt": 40, "shoot": [45, 77], "shop": [8, 10, 76], "short": [8, 13, 15, 63], "shortcom": 38, "shortcut": 57, "shorten": 22, "shortwav": 41, "shortwavearrai": 41, "shortwavelunit": 41, "should": [0, 7, 8, 12, 14, 15, 20, 22, 24, 25, 28, 29, 39, 41, 42, 43, 44, 45, 47, 50, 61, 68, 69, 72, 74, 80, 83, 87, 88], "shoutout": 52, "show": [7, 8, 10, 18, 25, 37, 41, 44, 46, 62, 65, 67, 72, 73, 79, 81, 87, 88], "showcas": [6, 8, 71], "shown": [8, 37, 42, 44, 46, 62, 65, 67, 81], "shrink": [25, 80, 81], "shum": 41, "shut": [8, 45, 74], "shutdown": 45, "shutil": 43, "side": [12, 39, 57, 59, 63, 71, 90], "sidebar": [59, 71], "sig": 6, "sigma": [47, 86], "sign": 6, "signatur": [17, 28, 80], "signific": [8, 80, 84, 90], "significantli": 2, "silenc": [46, 67, 84], "silin": 42, "silo": [25, 63], "silver": [8, 74], "similar": [8, 11, 20, 25, 44, 46, 61, 67, 68, 74, 83, 84, 88], "simpl": [8, 10, 15, 23, 25, 29, 37, 38, 63, 70, 73, 74, 80, 81, 82], "simplehttpserv": 1, "simpler": 80, "simplest": 74, "simpli": [11, 29, 61, 62, 87], "simplic": 23, "simplifi": [61, 62], "simul": [6, 25, 39, 47, 67, 72, 83, 86], "simulation_start_d": 67, "simultan": 17, "sin": [17, 73], "sin_rot": 86, "sinalpha": 67, "sinalpha_u": 67, "sinalpha_v": 67, "sinc": [7, 8, 11, 13, 15, 17, 18, 23, 28, 32, 35, 37, 38, 39, 41, 42, 43, 46, 57, 61, 62, 64, 65, 66, 67, 68, 69, 72, 73, 79, 80, 81, 83, 86, 88, 90], "sincer": 15, "sine": [67, 86], "singl": [7, 8, 12, 13, 18, 20, 24, 28, 29, 39, 41, 42, 45, 47, 59, 61, 63, 65, 67, 68, 71, 72, 73, 83, 84, 90, 92], "singlehdf5tozarr": 84, "sintake_esm_attr": 38, "sio2_flux_100m": 44, "sio2_prod": 44, "sio3": [18, 44], "sio3_riv_flux": 28, "sioaa0mt": 41, "siparc": [8, 86], "siphon": 78, "sit": [8, 15, 25, 79, 90], "site": [7, 8, 28, 29, 37, 38, 41, 42, 45, 61, 65, 67, 68, 80, 84, 87], "situ": [61, 86], "situat": [8, 51, 65, 69], "six": 68, "sizabl": [8, 89], "size": [7, 8, 17, 23, 25, 30, 31, 37, 41, 43, 46, 47, 53, 63, 72, 73, 80, 81, 83, 84], "sizemor": [8, 21], "skew": 73, "skill": [2, 8, 88, 91], "skintemp": 67, "skip": [7, 47, 83, 86, 87], "skip_instance_cach": [84, 86], "skipna": 73, "sky": [41, 63], "skyunit": 41, "slat": 46, "sleep": [8, 15], "slice": [11, 13, 17, 28, 37, 43, 46, 47, 61, 67, 68, 80], "slide": [8, 25, 89, 90, 92], "slider": 39, "slight": [32, 51], "slightli": [61, 80], "sloan": 63, "slon": 46, "slong_nam": 72, "slot": [6, 75], "slow": [25, 29, 74, 84, 87], "slowdown": 62, "slower": [31, 84], "slowli": [8, 10], "slurm": [8, 22, 43], "sm": 67, "sm000007": 67, "sm007028": 67, "sm028100": 67, "sm100289": 67, "small": [8, 10, 17, 24, 25, 63, 67, 73, 74, 77, 80, 81, 83, 85], "smaller": [7, 20, 28, 31, 47, 73, 84, 87], "smallest": [61, 80], "smart": 25, "smbb": [37, 46, 87], "smbb_plot": 46, "smith": 15, "smol_da": 73, "smolyar": 61, "smooth": [37, 46, 63], "smyle": [20, 32], "snail": 15, "snippet": [17, 71], "snoalb": 67, "snow": 67, "snowfrac": [20, 28], "snowh": 67, "snuff": 74, "so": [4, 6, 7, 8, 10, 11, 12, 13, 14, 15, 17, 19, 20, 21, 22, 25, 26, 27, 29, 32, 33, 34, 35, 39, 42, 43, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 63, 66, 68, 69, 70, 72, 73, 74, 78, 79, 80, 83, 84, 86, 87, 88, 90], "sobhani": [89, 92], "societ": 2, "societi": 63, "soft": 29, "softwar": [2, 8, 10, 11, 15, 25, 29, 32, 35, 40, 45, 56, 57, 63, 74, 77, 79, 82, 88, 90, 93], "soil": [67, 80], "soil_lay": 67, "soilcbot": 67, "soilctop": 67, "soilhgt": 67, "soiltemp": 67, "sol_tsi": [72, 83, 84], "solar": [36, 41, 63, 72, 83, 84], "sole": 15, "solid": 90, "solin": 41, "solut": [2, 6, 7, 8, 24, 30, 57, 73, 74, 80, 93], "solv": [2, 8, 10, 25, 28, 43, 60, 62, 72, 74], "some": [1, 6, 7, 8, 11, 12, 15, 16, 23, 24, 25, 29, 31, 32, 35, 37, 38, 39, 42, 43, 44, 47, 50, 61, 62, 63, 67, 68, 71, 72, 73, 74, 75, 76, 79, 80, 82, 83, 84, 86, 87, 88, 89, 90], "some_output_fil": 46, "some_vari": 30, "someberg": 15, "somehow": 45, "someon": [25, 74], "someth": [12, 15, 20, 22, 25, 29, 39, 45, 57, 63, 67, 69, 80], "somethingstagg": 67, "sometim": [11, 17, 24, 25, 73, 74, 87], "somewher": [15, 47, 74, 86], "son": [41, 81], "soon": [25, 28, 88, 91], "sophist": 15, "sophstic": 38, "sorghum": 80, "sort": [8, 24, 29, 39, 41, 67, 84, 86, 87], "sound": 63, "sourc": [2, 6, 8, 10, 12, 17, 23, 25, 28, 38, 39, 41, 44, 46, 51, 56, 61, 64, 67, 68, 70, 72, 73, 78, 80, 84, 86, 87], "source_": 41, "source_id": 42, "south": [41, 67], "south_north": 67, "south_north_stag": 67, "southeast": 61, "southerli": 67, "southern": 40, "southstagg": 67, "southwest": 61, "sp": 83, "space": [6, 7, 13, 14, 20, 25, 29, 31, 37, 41, 45, 59, 63, 73, 80, 86, 87, 90], "spacer": 18, "span": [8, 11, 16, 46, 82, 87], "spanish": 15, "spare": 80, "spars": [8, 25], "sparse_array_data": 83, "sparse_data": 80, "sparse_gpp": 80, "sparse_gpp_da": 80, "sparse_map": 83, "sparse_matrix": 80, "spatial": [8, 20, 23, 25, 37, 41, 47, 63, 72, 87], "spatial_domain": [36, 38, 46], "spatio": 25, "spatiotempor": [8, 41], "speak": [74, 80, 86], "speaker": [8, 24, 25, 63, 92], "speci": 63, "special": [14, 38, 39, 68, 69], "specialgeospatial_vertical_posit": 61, "specialti": 79, "specif": [6, 8, 14, 16, 18, 23, 24, 25, 29, 30, 42, 43, 46, 47, 50, 51, 52, 57, 59, 60, 62, 63, 64, 69, 72, 82, 84, 86, 88, 92], "specifi": [7, 11, 14, 15, 20, 22, 23, 28, 37, 39, 41, 43, 44, 45, 47, 48, 50, 52, 61, 64, 65, 67, 68, 69, 80, 81, 84, 86, 87], "specifici": 7, "spectral": [8, 46, 72, 83, 90], "speed": [7, 8, 25, 38, 62, 65, 86], "speedtime_avg_info": 86, "spend": [2, 40], "spent": 62, "sphere": 72, "sphinx": 74, "spill": [62, 87], "spin": [8, 22, 25, 52, 62], "split": [11, 24, 37, 41, 63, 84], "split_by_chunk": 17, "split_large_chunk": [37, 67], "spot": 6, "spread": [46, 88], "spreadsheet": 6, "spring": [8, 40], "spring_wheat": 80, "sprint": 63, "spyder": 12, "sqrt": [17, 38], "squar": [13, 61, 72, 80, 83, 88], "squarespac": 88, "src": [18, 83], "src_grid_dim": [72, 83], "src_grid_rank": [72, 83], "srclat": 83, "srclon": 83, "ssh": [7, 21, 57, 58, 66, 86], "ssmi_09_climo": 41, "ssmi_seaice_djf_climo": 41, "ssp370": [37, 46, 68], "sss": 20, "sst": [20, 46, 63, 67, 81], "sst2": 20, "ssu": 86, "ssv": 86, "st": 67, "st000007": 67, "st007028": 67, "st028100": 67, "st100289": 67, "sta": [76, 77, 92], "stabl": [22, 37, 38, 41, 43, 46, 52, 61, 62, 67, 68, 83, 84, 86, 87], "stac": 25, "stack": [4, 7, 18, 23, 24, 29, 31, 39, 45, 47, 68, 73, 74, 80, 83], "stackplot": 39, "stackstac": 25, "staf": 32, "staff": [2, 6, 79, 91, 92], "stage": [35, 87], "stagger": [25, 46, 67], "stai": 63, "stakehold": [2, 6], "stand": [28, 64, 67], "standard": [8, 11, 29, 40, 56, 61, 63, 67, 69, 70, 78, 84], "standard_deviationgrid_map": 61, "standard_errorlong_nam": 61, "standard_nam": [11, 46, 61, 81, 86, 87], "stanislaw": 77, "star": 77, "start": [0, 4, 8, 10, 12, 13, 14, 15, 16, 17, 20, 24, 25, 28, 29, 36, 37, 38, 39, 41, 42, 44, 46, 47, 50, 53, 57, 61, 63, 65, 67, 68, 71, 73, 74, 77, 80, 81, 82, 83, 84, 86, 90], "start_tim": [20, 36, 37, 38, 46, 61], "startbound": 46, "stash": [19, 26, 27], "stat": 63, "state": [6, 8, 24, 25, 28], "statement": [7, 13, 14], "stati": 46, "static": [2, 8, 23, 36, 39, 46, 50, 79, 87, 93], "static_ref": 86, "staticdict": 86, "staticfil": 86, "station": [8, 30], "statist": [25, 61, 81, 93], "statu": [12, 17, 22, 35, 37, 38, 41, 43, 45, 46, 52, 61, 67, 68, 73, 83, 84, 86, 87], "std": 83, "stem": [8, 41, 74], "step": [0, 2, 8, 11, 12, 13, 15, 17, 20, 21, 23, 28, 38, 42, 43, 44, 50, 52, 53, 57, 58, 61, 63, 65, 67, 73, 74, 80, 83], "stephan": 17, "sterzing": [8, 32, 86], "steve": [8, 23, 32, 42], "still": [8, 10, 14, 15, 25, 39, 40, 41, 42, 44, 45, 46, 47, 52, 56, 61, 68, 70, 73, 74, 78, 79, 80, 84, 88, 90, 93], "stop": [8, 12, 13, 15, 17, 32, 53, 74, 76], "storag": [4, 25, 63, 84, 86], "storage_opt": [18, 38, 46, 68], "store": [8, 13, 18, 22, 25, 28, 37, 38, 41, 46, 61, 62, 65, 68, 73, 80, 83, 84, 86], "str": [18, 28, 36, 41, 50, 72, 83], "straight": 73, "straightforward": 68, "strateg": 63, "strategi": [2, 30, 31, 44], "stream": [8, 20, 28, 37, 39, 41, 43, 50, 61, 62, 86], "streamlin": 83, "street": 15, "stress": [25, 67], "strftime": [15, 17, 41], "strict": 73, "strictli": [69, 86], "string": [8, 14, 15, 37, 53, 81, 83], "stringer": 2, "strive": 93, "structur": [2, 8, 16, 25, 44, 50, 62, 63, 82, 86], "struggl": [8, 11, 15, 24, 42, 62, 74], "stuck": 73, "student": 63, "studi": [40, 75], "studio": [8, 57], "stuff": 15, "sub": [73, 86], "subcolumnarrai": 72, "subfold": 86, "subgrid": 67, "subgroup": 90, "subject": 40, "submit": [28, 29, 31, 77, 85, 88], "suboptim": 73, "subplot": [37, 48, 65], "subplot_kw": 80, "subscript": 83, "subsequ": [60, 69], "subset": [7, 8, 20, 23, 31, 38, 42, 43, 47, 51, 67, 68, 80, 81, 84, 86, 88], "subset_d": 37, "subset_to_singleton": 47, "substanti": [20, 62, 80], "substit": 15, "substitut": [15, 44], "substr": 28, "subtl": [11, 68, 84], "subtract": [8, 46, 73, 80], "succeed": 74, "success": [6, 8, 10, 12, 25], "successfulli": 84, "sucsat": 80, "sudden": 73, "suddenli": [11, 73], "sudo": 12, "sugarbeet": 80, "sugarcan": 80, "suggeest": 29, "suggest": [6, 7, 12, 29, 31, 61], "suit": 71, "suitabl": [8, 22, 47], "sum": [46, 61, 68, 73, 86], "sumgrid_map": 61, "summ": 83, "summar": [8, 24, 81], "summari": [7, 8, 18, 30, 31, 59, 61], "summary_map": 18, "summer": [8, 40, 41], "summit": [8, 32], "sundai": 63, "sundown": [8, 12], "sunflow": 80, "sunseon": [84, 87], "sunseonhost": [84, 87], "sunseonmodel_doi_url": 84, "sunwai": 72, "sunway_02": [23, 51], "sunway_02titl": 23, "super": [67, 68], "supercomput": [8, 10], "supersed": 46, "suppli": [11, 53], "support": [2, 6, 8, 10, 11, 12, 23, 24, 25, 28, 29, 32, 40, 41, 48, 53, 63, 72, 73, 76, 78, 81, 83, 92, 93], "suppos": 74, "sure": [0, 8, 17, 21, 22, 24, 28, 29, 30, 31, 32, 37, 39, 42, 44, 45, 50, 57, 58, 62, 68, 74, 75, 81, 86, 87, 88], "surfac": [10, 17, 36, 37, 39, 46, 47, 61, 63, 65, 67, 68, 80, 81, 86], "surfacestatist": [46, 81], "surfacetitl": 46, "surfdata_0": 80, "surprisingli": 73, "survei": 90, "susan": 2, "suspici": 46, "sustain": [2, 63], "svg": [18, 48, 50], "swap_dim": 11, "swcf": 41, "switch": [0, 8, 16, 84, 88], "switchgrass": 80, "sy": [23, 46, 51, 67, 68, 72, 83, 84, 86], "sylvania": 15, "symbol": 14, "sync": [4, 71, 88], "synchron": 78, "syndrom": [8, 74], "syntax": [7, 13, 15, 36, 42, 43, 44, 50, 61, 65, 74], "synthes": [2, 44], "synthesi": 2, "system": [2, 3, 4, 6, 7, 12, 20, 23, 24, 28, 29, 30, 31, 36, 37, 40, 41, 42, 46, 52, 56, 62, 80, 84, 86, 88, 92], "szaunit": 72, "t": [7, 8, 10, 11, 12, 13, 14, 23, 25, 28, 29, 38, 39, 45, 46, 47, 50, 51, 52, 61, 63, 67, 68, 69, 72, 73, 74, 81, 84, 86, 87, 88, 90], "t_": 61, "t_an": 61, "t_cmip6": 46, "t_cmip6_mean": 46, "t_cmip6_t": 46, "t_cmip6_ts_df": 46, "t_dd": 61, "t_gp": 61, "t_ma": 61, "t_mn": 61, "t_oa": 61, "t_ref": 46, "t_ref_mean": 46, "t_ref_t": 46, "t_sd": 61, "t_se": 61, "t_smbb": 46, "t_smbb_mean": 46, "t_smbb_t": 46, "t_smbb_ts_df": 46, "tab": [7, 47], "tabl": [1, 8, 20, 28, 59, 61, 85, 86, 91], "table_id": 42, "tag": [0, 44, 71], "tair": [17, 71], "take": [8, 11, 12, 14, 15, 17, 20, 25, 28, 29, 37, 39, 41, 43, 45, 46, 47, 50, 53, 59, 61, 62, 63, 67, 74, 80, 81, 84, 86, 87], "takeawai": [8, 32, 59, 92], "taken": 25, "talk": [6, 8, 11, 12, 15, 24, 30, 31, 62, 63], "tall": 10, "tarea": 43, "target": 2, "target_opt": 84, "tarrai": 87, "task": [8, 17, 20, 24, 28, 29, 31, 36, 38, 39, 41, 43, 44, 46, 47, 57, 61, 62, 67, 68, 73, 74, 80], "tavg": 61, "taysia": [8, 76, 85, 91, 92], "tb": [8, 25, 29, 43, 46], "tba": [8, 34, 60], "tbd": 16, "tbodi": 18, "tbot": 37, "tbound": 81, "tc": [38, 83], "tclimatologi": 61, "tcoordinate_defin": 46, "tcp": [17, 37, 38, 41, 46, 61, 67, 68, 73, 83, 84, 86, 87], "tdry": 65, "teach": [8, 10, 15, 35, 56, 74], "teacher": [8, 15], "teagan": [2, 92], "team": [8, 10, 16, 17, 24, 25, 29, 30, 31, 33, 34, 40, 56, 59, 60, 62, 63, 64, 93], "tech": 63, "technic": [2, 6, 8, 16, 61, 90], "techniqu": [8, 19, 34, 60, 73, 91], "technologi": [2, 6, 8, 10, 29], "tell": [12, 80, 83, 90], "temp": [17, 23, 28, 39, 43, 44, 47, 61, 68, 81], "temp_100m_mean": 43, "temp_depth": 47, "temp_sum": 68, "temperate_corn": 80, "temperate_soybean": 80, "temperatur": [7, 23, 37, 38, 39, 42, 43, 47, 61, 63, 67, 68, 81], "temperature_plot": 65, "temperaturecell_method": [23, 41, 84], "temperatureclimatologi": 41, "temperaturedataset": 81, "temperaturekeywords_vocabulari": 61, "temperaturelevel_desc": 46, "temperaturemdim": 84, "temperaturestagg": 67, "temperaturestandard_nam": 86, "temperaturetype_pref": 17, "temperatureunit": [39, 46, 61, 68], "temperatureunpacked_valid_rang": 81, "tempest": 24, "tempestremap": [83, 90], "templat": [8, 47, 50, 71], "tempor": [8, 20, 25, 32, 41, 42, 61, 63], "temporari": [7, 63], "tempout": 13, "tempt": [68, 81], "ten": 10, "tenant": 11, "tend": [69, 88], "tendenc": 37, "tension": 15, "tensordot": [8, 72, 73], "tent": 29, "tenth": 61, "terabyt": [46, 62, 87], "term": [20, 24, 25, 29, 32, 36, 38, 39, 42, 63, 87], "termin": [0, 7, 8, 19, 21, 26, 27, 30, 40, 45, 50, 55, 56, 57, 58, 66, 70, 78, 82], "terminologi": 86, "terrain": 67, "terrestri": [24, 80], "test": [8, 10, 17, 19, 21, 23, 25, 26, 27, 28, 38, 40, 41, 43, 46, 47, 53, 55, 58, 63, 66, 68, 70, 74, 78], "test_1x777602_768x1152_peri": 83, "test_history_fil": 20, "test_timeseries_fil": 20, "tester": 24, "text": [0, 12, 13, 15, 18, 50, 61, 63, 69], "tf": 23, "th": [18, 57, 72], "than": [8, 10, 15, 20, 25, 40, 45, 47, 53, 61, 63, 67, 68, 74, 81, 87, 88], "thank": [17, 73, 76, 92], "thead": 18, "thei": [2, 7, 8, 10, 11, 14, 15, 16, 20, 23, 25, 29, 39, 41, 46, 47, 48, 53, 57, 61, 62, 63, 69, 79, 81, 93], "them": [8, 12, 13, 15, 23, 25, 29, 61, 62, 65, 68, 69, 72, 78, 79, 80, 86, 87, 88], "themselv": [10, 37], "theori": [62, 83], "thetao": [42, 86], "thi": [0, 1, 2, 3, 4, 5, 6, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 48, 49, 50, 51, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93], "thick": 86, "thicknesstime_avg_info": 86, "thing": [10, 12, 14, 15, 16, 25, 62, 63, 68, 73, 80, 81, 86, 88, 90], "think": [4, 8, 10, 11, 15, 28, 39, 43, 47, 48, 63, 74, 80, 86], "third": [8, 12, 14, 16, 36, 44], "thoma": [2, 89], "those": [2, 8, 12, 13, 14, 15, 20, 23, 24, 38, 39, 41, 42, 43, 44, 50, 63, 67, 73, 75, 80, 81, 83, 87, 90], "though": [8, 10, 15, 28, 29, 35, 41, 51, 62, 65, 69, 74, 88, 90], "thought": [17, 74], "thread": [7, 28, 37, 38, 41, 44, 46, 47, 61, 67, 68, 73, 80, 83, 84, 86, 87], "threads_per_work": 86, "threat": 63, "thredd": [46, 61], "three": [8, 13, 17, 18, 39, 50, 59, 63], "threshold": [47, 63], "through": [4, 6, 7, 8, 12, 13, 15, 16, 18, 29, 30, 32, 37, 47, 50, 62, 63, 64, 71, 72, 73, 74, 77, 82, 84, 85, 89, 90, 91], "throughout": [7, 8, 12, 41, 59, 62, 74, 78, 86, 90], "thu": [2, 8, 32, 41, 59], "thumb": 7, "thumbnail": 18, "thurdai": [8, 82], "thursdai": [8, 75, 77, 85], "ti": 69, "tib": [46, 61], "tick": [81, 84], "tick_param": 81, "ticket": 7, "ticksiz": 37, "tiff": 86, "tild": 87, "time": [0, 2, 6, 8, 10, 12, 14, 15, 16, 17, 18, 22, 23, 24, 25, 26, 27, 28, 29, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 50, 51, 52, 53, 56, 57, 59, 62, 63, 64, 66, 68, 69, 70, 72, 73, 74, 77, 78, 79, 80, 81, 84, 86, 87, 88, 93], "time_bnd": [7, 23, 38, 46, 51, 72, 81, 83, 84, 86, 87], "time_bnds_varnam": 43, "time_bndsactual_rang": 46, "time_bndsarrai": [23, 41, 72, 81, 83, 84], "time_bndsaxi": 87, "time_bndscalendar_typ": 86, "time_bndslong_nam": [38, 46, 84], "time_bndsxarrai": 81, "time_bound": [7, 43, 68, 80], "time_bound_diff": 46, "time_boundarrai": 61, "time_boundlong_nam": 68, "time_bounds_dim_nam": 7, "time_boundsarrai": 80, "time_cent": 43, "time_constant_3dvar": 80, "time_constant_3dvars_filenam": 80, "time_dt": 11, "time_encod": 43, "time_offset": 65, "time_period": [18, 41], "time_period_freq": [28, 39, 61, 68, 80, 84, 87], "time_rang": [20, 37, 42], "time_seri": 18, "time_written": [28, 72, 80, 83, 84], "timeactual_rang": 81, "timearrai": [38, 46, 61, 68, 84, 86], "timeaxi": [46, 81], "timebound": [23, 41, 61, 72, 80, 83, 84, 87], "timedelta64": 86, "timedelta_t": 46, "timegrid_loc": 68, "timeit": [53, 83], "timelong_nam": [41, 61, 87], "timepandasindexpandasindex": [72, 81, 83, 84, 86, 87], "timeseri": [8, 18, 28, 32, 37, 39, 63, 73, 87], "timeseries_catalog": 20, "timestamp": 7, "timestep": [18, 42, 67, 72, 84, 87], "timestepunit": [72, 83, 84], "timetype_pref": 17, "timeunit": 61, "timexarrai": [46, 65], "tina": 25, "tip": [0, 11, 12, 74, 90], "tire": 16, "titl": [0, 8, 15, 17, 23, 28, 37, 38, 39, 41, 44, 46, 50, 51, 61, 64, 67, 68, 70, 72, 80, 81, 83, 86, 88], "tl319_g17": 20, "tl319_t061_zstar_n65": 86, "tl319_t13": [18, 61], "tlat": [28, 39, 43, 61, 68], "tlong": [28, 39, 43, 61, 68], "tlong_nam": 86, "tmp": [80, 86, 87], "tmpdir": [22, 43, 52], "tmpfile": 87, "to_csv": 46, "to_dataset": [11, 83], "to_dataset_dict": [20, 28, 39, 41, 42, 43, 61], "to_datetim": [11, 65], "to_datetimeindex": [11, 46], "to_netcdf": [7, 17, 43, 61, 80], "to_numpi": 80, "to_seri": 46, "to_spars": 80, "to_zarr": [7, 61, 80], "toa": 41, "toastandard_nam": 41, "toctre": 1, "todai": [15, 63, 87], "todens": [80, 83], "todo": 86, "togeth": [2, 4, 8, 23, 24, 29, 36, 39, 42, 46, 47, 62, 63, 64, 67, 73, 75, 76, 87, 90], "toggl": 88, "toil": 29, "tolist": [72, 83], "tom": 89, "ton": 45, "too": [8, 10, 25, 36, 47, 61, 62, 63, 68, 74, 84, 87], "took": [8, 10, 32, 40, 80, 83], "tool": [2, 6, 7, 8, 10, 11, 20, 24, 25, 28, 30, 31, 36, 39, 40, 43, 44, 50, 57, 61, 63, 65, 77, 78, 83, 90], "toolbar": [12, 23], "toolkit": [24, 28, 77, 93], "top": [0, 8, 15, 18, 25, 36, 37, 39, 40, 41, 43, 44, 50, 53, 56, 57, 59, 63, 65, 67, 68, 70, 78, 86], "top_grid_dimens": 67, "top_left": 65, "topic": [6, 8, 16, 24, 29, 32, 39, 62, 63, 77, 82, 83, 85, 90], "topo": [23, 38, 51, 72, 83, 84, 87], "topographi": 67, "topography_fil": [23, 51, 72, 83, 84, 87], "topographystagg": 67, "tos": 86, "tostack": 80, "total": [8, 13, 15, 23, 30, 31, 32, 37, 38, 39, 41, 51, 61, 67, 68, 72, 73, 83, 84, 86, 87, 90], "total_area": 46, "touch": [15, 69, 86], "tough": [25, 36, 63], "tour": 40, "toward": [2, 8, 10, 15, 24, 25, 29, 63, 64, 74], "town": [8, 32, 64], "tr": 18, "trace": 73, "traceback": [28, 41, 80], "tracer": [38, 86], "track": [0, 6, 7, 12, 35, 63, 73, 92], "tracker": [63, 73], "tradeoff": 47, "tradit": [2, 37, 38, 44, 84, 86], "tradition": [8, 67], "trahan": 92, "trail": [8, 71], "train": [2, 6, 8, 25, 29, 32, 59], "transfer": [46, 62, 73], "transfer_funct": 23, "transform": [2, 17, 23, 41, 67, 71, 80, 81, 91], "transit": [2, 8, 11, 22, 25], "translat": [2, 84, 86], "transpar": 63, "transport": 72, "transportstandard_nam": 86, "transportxarrai": 72, "transpos": [47, 72, 80, 83], "treat": 69, "tree": [80, 86], "trefht": 23, "trefht_camne120": 23, "trend": [8, 63, 73], "trend_hist": 18, "trend_map": 18, "trendi": 80, "trendy2019_histori": 80, "trendy2019_s0_constant_v2": 80, "trendy2019_s0_constant_v2surface_dataset": 80, "trendy2019_s0_control_v2": 80, "tri": [15, 23, 74, 80], "trial": [8, 23, 43], "triang": 23, "triangl": [8, 23], "triangul": [23, 83], "triangular": 23, "tricki": [7, 8, 51, 67, 68, 81], "trigger": [7, 42, 44], "trim": 80, "trim_block": 15, "trivial": 87, "trmm_mam_climo": 41, "tropic": [63, 90, 92], "tropical_corn": 80, "tropical_soybean": 80, "tropopaus": 37, "troubl": [7, 45, 67, 75, 77], "troubleshoot": [75, 76], "true": [7, 8, 15, 17, 18, 20, 23, 28, 36, 37, 38, 39, 41, 43, 46, 47, 61, 67, 68, 72, 73, 80, 83, 84, 86, 87], "truediv": 68, "truevalid_rang": 80, "truncat": [46, 72, 83], "truth": 71, "try": [7, 8, 12, 17, 23, 25, 39, 41, 43, 45, 67, 68, 69, 73, 74, 75, 83, 84], "ts_remap": 83, "tseri": [7, 20, 28, 72, 84], "tsfc": [20, 28], "tsfile": 83, "tss": 80, "tstandard_nam": 86, "tt": 67, "tte_cesm": 43, "tue": 17, "tuesdai": [8, 63, 66], "tune": 23, "tupl": 80, "turn": [8, 12, 42, 73, 74, 80, 83, 86], "tutori": [6, 8, 10, 15, 17, 29, 50, 62, 63, 75, 76, 77, 81, 83, 85, 90], "tutorial_2021_12_08": 40, "tweet": [8, 23], "twenti": 39, "twice": 30, "twilight": 72, "two": [7, 8, 10, 11, 12, 14, 17, 23, 28, 30, 34, 38, 39, 41, 42, 44, 45, 46, 50, 51, 57, 61, 62, 63, 68, 71, 72, 79, 80, 81, 84, 86, 88, 90, 92], "tx0": 61, "txt": [8, 12, 16, 44, 82], "tycoon": 15, "tyle": 89, "type": [8, 11, 12, 13, 14, 15, 17, 18, 19, 20, 21, 22, 23, 25, 26, 27, 28, 32, 37, 38, 39, 41, 43, 45, 46, 48, 49, 50, 52, 53, 56, 57, 58, 61, 63, 66, 67, 68, 71, 72, 73, 74, 80, 83, 84, 86, 87, 90], "typeerror": 83, "typefloat32shap": 80, "typefloat64shap": [80, 83], "typeformatcoodata": 80, "typeint64shap": 80, "typestagg": 67, "typexarrai": 80, "typic": [8, 11, 12, 17, 23, 24, 25, 28, 29, 36, 44, 59, 62, 63, 64, 67, 68, 84], "tyx": 83, "u": [6, 7, 8, 10, 13, 16, 17, 19, 21, 22, 23, 25, 26, 27, 28, 32, 37, 38, 39, 43, 44, 46, 49, 51, 52, 54, 55, 58, 61, 63, 65, 66, 67, 69, 73, 79, 80, 83, 84, 87, 89, 90], "u11": 41, "u12": [46, 68], "u34": 39, "uat": [20, 28], "ubuntu": 44, "uc": 63, "ucar": [2, 6, 7, 8, 18, 19, 21, 22, 26, 27, 28, 33, 34, 35, 37, 38, 39, 40, 41, 43, 46, 49, 52, 54, 55, 56, 57, 58, 60, 61, 62, 66, 67, 68, 70, 78, 79, 82, 83, 84, 86, 87, 88, 91], "ucp": 8, "uhgm": 86, "uhml": 86, "ujson": [84, 86], "uk": [8, 10], "ulat": [28, 39, 61], "ulong": [28, 39, 61], "ulrik": 2, "ultim": 74, "umo": 86, "unabl": [8, 16, 20, 28, 41], "unchunk": 73, "uncompress": [20, 28, 41, 80], "undeclar": 15, "undefin": 12, "under": [7, 20, 21, 29, 37, 43, 58, 66, 80, 83, 88], "underappreci": [8, 80], "undergradu": 2, "underli": [23, 25, 29, 80, 84], "underneath": [62, 80], "underpin": 2, "underrepres": 2, "underscor": 13, "understand": [8, 10, 25, 35, 36, 47, 50, 62, 63, 71, 74, 81, 82], "understood": 11, "unexpect": [73, 80, 83], "unfamiliar": [8, 12, 42], "unflag": 61, "unfortun": 81, "unidata": [2, 32, 40, 59, 64, 78, 87], "unifi": [61, 86], "uniform": [25, 72], "unify_chunk": 61, "uninstal": [30, 45, 75], "union": 20, "uniqu": [16, 18, 20, 28, 36, 37, 38, 39, 43, 46, 50, 61, 80], "unit": [11, 17, 20, 23, 36, 37, 38, 39, 41, 46, 47, 61, 67, 68, 72, 80, 81, 83, 84, 86, 87], "unitless": [72, 83], "univers": [2, 40, 59], "unix": 87, "unless": 87, "unlik": 71, "unlimited_dimens": 46, "unlock": 25, "unnam": 18, "unpack": 67, "unpacked_valid_rang": 81, "unprepar": [8, 15], "unscal": 10, "unseen": 63, "unset": [15, 23, 51, 72, 83], "unsetcase_id": 80, "unsetlognam": [23, 72, 83], "unsettopography_fil": 38, "unspecifi": 47, "unstack": [46, 47], "unstructur": [8, 24, 25, 30, 32, 72, 83, 85, 92, 93], "unsupris": 20, "until": [8, 66, 91], "unus": 45, "unweight": [8, 81], "unzip": 65, "uo": 86, "up": [0, 4, 6, 8, 12, 13, 14, 15, 22, 25, 28, 29, 30, 31, 32, 45, 50, 52, 59, 61, 62, 63, 64, 73, 74, 75, 77, 79, 80, 81, 86, 87, 88, 90], "updat": [6, 7, 8, 16, 19, 21, 22, 24, 26, 28, 32, 33, 34, 35, 43, 45, 46, 49, 54, 55, 56, 58, 60, 66, 70, 72, 74, 78, 80, 82, 83, 86, 87], "upgrad": [11, 29, 73], "upon": [30, 80, 81], "upper": [0, 7, 41], "upstream": [0, 19, 25, 26, 27, 73], "uptak": 80, "upwel": 36, "urb_param": 67, "urban": [67, 80], "urban_paramet": 67, "urban_parametersstagg": 67, "urbana": 40, "url": [22, 37, 43, 46, 50, 52, 84], "us": [0, 1, 2, 4, 6, 8, 10, 11, 12, 13, 14, 16, 17, 18, 25, 29, 30, 31, 32, 34, 35, 40, 42, 45, 48, 49, 51, 53, 59, 60, 62, 63, 64, 68, 69, 73, 74, 77, 78, 79, 81, 82, 84, 87, 88, 90, 93], "usabl": [67, 93], "usag": [12, 13, 43, 45, 62, 88], "usd": 63, "use_cftim": [20, 28, 39, 86], "useless": [83, 86], "user": [0, 2, 6, 7, 8, 10, 12, 17, 20, 22, 23, 29, 31, 37, 38, 41, 42, 43, 44, 45, 46, 51, 52, 57, 61, 62, 67, 68, 71, 72, 73, 83, 84, 86, 87, 88, 90], "user_global_n": [37, 41], "user_n": [37, 41], "userbas": 25, "usernam": [43, 45, 57], "userwarn": [20, 28, 38, 41, 68, 84, 87], "usg": [23, 38, 72, 83], "usr": [22, 43, 52, 87], "usr_x": 67, "ustagg": 67, "usual": [7, 8, 10, 11, 23, 73, 74, 80, 81, 84, 86], "util": [8, 22, 23, 24, 31, 40, 43, 46, 47, 51, 52, 61, 62, 63, 65, 67, 81, 83, 87, 93], "utils_perf": 46, "uu": 67, "uvel": [20, 28], "uxarrai": [77, 83, 85, 90, 92], "v": [8, 12, 14, 25, 32, 38, 41, 61, 62, 67, 80, 84, 86], "v0": 23, "v1": [23, 44], "v2": [8, 23, 44, 46], "v2level_desc": 81, "v2pl2gv5": 37, "v3": [44, 46], "v3sourc": 46, "v4": 67, "v49contributor_nam": 61, "va": 0, "vacat": 88, "valid": [15, 39, 44, 61], "valid_rang": 81, "validation_mct": [39, 44], "validation_nu": 39, "validation_nuopc": [39, 44], "valparaiso": 40, "valu": [11, 13, 14, 17, 18, 23, 28, 32, 37, 38, 39, 46, 47, 48, 50, 61, 63, 65, 68, 71, 72, 74, 80, 81, 83, 84, 86, 87], "valuabl": [8, 10, 17, 24, 62, 88, 90], "valueerror": 80, "vander": 73, "vanderwend": 92, "vapor": [72, 77, 92], "vapour": 72, "var": [61, 67, 68, 72, 80, 83], "var_desc": 81, "var_nam": 15, "var_sso": 67, "vari": [30, 53, 62, 80, 88], "variabl": [7, 8, 11, 12, 13, 14, 15, 17, 20, 23, 24, 25, 28, 31, 36, 39, 41, 42, 43, 44, 46, 50, 51, 61, 63, 65, 68, 69, 71, 72, 73, 74, 80, 84, 86, 87], "variable_column_nam": [20, 28, 41], "variable_id": 42, "variable_typ": 44, "variablescalendar": [39, 61], "variablesmodel_doi_url": 68, "varianc": [37, 67], "variant": [37, 46], "varieti": [8, 24, 30, 31, 32, 59, 61, 62, 63, 83, 86], "variou": [6, 7, 18, 20, 29, 39, 44, 59, 63, 90], "varl": 67, "varlst": 83, "varnam": [18, 83], "vars_with_ncol": [72, 83], "varss": 67, "vdim": 23, "ve": [8, 11, 69, 83, 89], "vector": [73, 80], "vegcod": 80, "veget": 80, "veloc": [36, 67, 86], "velocitystandard_nam": 86, "velocitytime_avg_info": 86, "venu": 6, "verbal": 74, "veri": [7, 8, 10, 15, 17, 20, 23, 28, 29, 63, 71, 73, 79, 81, 83, 86, 89, 90], "verifi": [0, 7, 80], "veriou": 7, "version": [2, 7, 8, 19, 21, 23, 26, 27, 35, 40, 41, 44, 45, 46, 49, 51, 54, 55, 56, 58, 61, 66, 69, 70, 71, 72, 78, 80, 83, 86, 87, 91], "vert": 23, "vertex": 86, "vertic": [7, 8, 18, 23, 32, 36, 39, 41, 43, 50, 63, 72], "vertical_level": [20, 36, 37, 38], "vhgm": 86, "vhml": 86, "via": [0, 1, 6, 7, 8, 22, 36, 37, 39, 42, 43, 44, 59, 74, 79, 86, 90, 91], "vic": 17, "victori": 74, "video": [7, 8, 12, 32, 35, 40, 53, 57], "view": [1, 4, 18, 20, 24, 29, 39, 43, 52, 62, 75], "viewabl": [62, 65], "villag": 63, "vim": 12, "viridi": 38, "virtual": [6, 8, 16, 19, 21, 26, 27, 33, 34, 35, 45, 49, 54, 55, 56, 58, 62, 63, 66, 70, 75, 77, 78, 84, 85, 91], "virtualgl": 6, "visibl": [44, 45], "vision": [8, 10, 29, 32], "visit": [40, 90], "visual": [8, 17, 18, 23, 31, 39, 44, 57, 60, 63, 65, 68, 71, 73, 75, 76, 77, 78, 84, 85, 90, 92, 93], "vital": 90, "viz": [7, 8, 33, 39, 60, 63, 77, 81], "vmax": [68, 81], "vmin": [68, 81], "vmo": 86, "vnt": 36, "vo": 86, "voic": 6, "volcello": 86, "volum": [8, 59, 61, 72, 83, 84, 86], "volumestandard_nam": 86, "volunt": [2, 63], "vsr_x": 67, "vstagger": 67, "vufi_4f6": 41, "vv": [0, 67], "vve": 36, "vvel": [20, 28, 36], "vvvvvvvabaaaaaaaaaaeafvvvvvvqaqaqqqqqqqgbaeaaaaaaaaeasqqqqqqoaqbvvvvvvvqbagaaaaaaaaeaaqqqqqqoaqb1vvvvvvqbaiaaaaaaaaeahvvvvvvuaqckqqqqqqobajaaaaaaaaealvvvvvvuaqcaqqqqqqobakaaaaaaaaeapvvvvvvuaqcqqqqqqqobalaaaaaaaaeatvvvvvvuaqc6qqqqqqobamaaaaaaaaeawqqqqqqqaqdfvvvvvvubamgaaaaaaaeayqqqqqqqaqdnvvvvvvubanaaaaaaaaea0qqqqqqqaqdvvvvvvvubangaaaaaaaea2qqqqqqqaqddvvvvvvubaoaaaaaaaaea4qqqqqqqaqdlvvvvvvubaogaaaaaaaea6qqqqqqqaqdtvvvvvvubapaaaaaaaaea8qqqqqqqaqd1vvvvvvubapgaaaaaaaea": 86, "vvvvvvvjab4aaaaaaambvaqqqqqqowg9vvvvvvvjab0aaaaaaambvkqqqqqqowg8vvvvvvvjabwaaaaaaambu6qqqqqqowg7vvvvvvvjabsaaaaaaambuqqqqqqqowg6vvvvvvvjaboaaaaaaambuaqqqqqqowg5vvvvvvvjabkaaaaaaambukqqqqqqowg4vvvvvvvjabgaaaaaaambt6qqqqqqowg3vvvvvvvjabcaaaaaaambtqqqqqqqowg2vvvvvvvjabyaaaaaaambtaqqqqqqowg1vvvvvvvjabuaaaaaaambtkqqqqqqowg0vvvvvvvjabqaaaaaaambs6qqqqqqowgzvvvvvvvjabmaaaaaaambsqqqqqqqowgyvvvvvvvjabiaaaaaaambsaqqqqqqowgxvvvvvvvjabeaaaaaaambskqqqqqqowgwvvvvvvvjabaaaaaaaambr6qqqqqqowgvvvvvvvvjaa8aaaaaaambrqqqqqqqwwguvvvvvvvjaa4aaaaaaambraqqqqqqwwgtvvvvvvvjaa0aaaaaaambrkqqqqqqwwgsvvvvvvvjaawaaaaaaambq6qqqqqqwwgrvvvvvvvjaasaaaaaaambqqqqqqqqwwgqvvvvvvvjaaoaaaaaaambqaqqqqqqwwgpvvvvvvvjaakaaaaaaambqkqqqqqqwwgovvvvvvvjaagaaaaaaambp6qqqqqqwwgnvvvvvvvjaacaaaaaaambpqqqqqqqwwgmvvvvvvvjaayaaaaaaambpaqqqqqqwwglvvvvvvvjaauaaaaaaambpkqqqqqqwwgkvvvvvvvjaaqaaaaaaambo6qqqqqqwwgjvvvvvvvjaamaaaaaaamboqqqqqqqwwgivvvvvvvjaaiaaaaaaamboaqqqqqqwwghvvvvvvvjaaeaaaaaaambokqqqqqqwwggvvvvvvvjaaaaaaaaaambn6qqqqqqwwgfvvvvvvvjaz8aaaaaaambnqqqqqqqwwgevvvvvvvjaz4aaaaaaambnaqqqqqqwwgdvvvvvvvjaz0aaaaaaambnkqqqqqqwwgcvvvvvvvjazwaaaaaaambm6qqqqqqwwgbvvvvvvvjazsaaaaaaambmqqqqqqqwwgavvvvvvvjazoaaaaaaambmaqqqqqqwwgzvvvvvvvjazkaaaaaaambmkqqqqqqwwgyvvvvvvvjazgaaaaaaambl6qqqqqqwwgxvvvvvvvjazcaaaaaaamblqqqqqqqwwgwvvvvvvvjazyaaaaaaamblaqqqqqqwwgvvvvvvvvjazuaaaaaaamblkqqqqqqwwguvvvvvvvjazqaaaaaaambk6qqqqqqwwgtvvvvvvvjazmaaaaaaambkqqqqqqqwwgsvvvvvvvjaziaaaaaaambkaqqqqqqwwgrvvvvvvvjazeaaaaaaambkkqqqqqqwwgqvvvvvvvjazaaaaaaaambj6qqqqqqwwgpvvvvvvvjay8aaaaaaambjqqqqqqqwwgovvvvvvvjay4aaaaaaambjaqqqqqqwwgnvvvvvvvjay0aaaaaaambjkqqqqqqwwgmvvvvvvvjaywaaaaaaambi6qqqqqqwwglvvvvvvvjaysaaaaaaambiqqqqqqqwwgkvvvvvvvjayoaaaaaaambiaqqqqqqwwgjvvvvvvvjaykaaaaaaambikqqqqqqwwgivvvvvvvjaygaaaaaaambh6qqqqqqwwghvvvvvvvjaycaaaaaaambhqqqqqqqwwggvvvvvvvjayyaaaaaaambhaqqqqqqwwgfvvvvvvvjayuaaaaaaambhkqqqqqqwwgevvvvvvvjayqaaaaaaambg6qqqqqqwwgdvvvvvvvjaymaaaaaaambgqqqqqqqwwgcvvvvvvvjayiaaaaaaambgaqqqqqqwwgbvvvvvvvjayeaaaaaaambgkqqqqqqwwgavvvvvvvjayaaaaaaaambf1vvvvvvgwf": 86, "vvvvvvvjab8aaaaaaambvqqqqqqqowg": 86, "vvvvvvwaaaaaaaaaaaad": 86, "vvvvvvwawd6qqqqqqsdapgaaaaaaama9vvvvvvwawdyqqqqqqsdapaaaaaaaama7vvvvvvwawdqqqqqqqsdaogaaaaaaama5vvvvvvwawdiqqqqqqsdaoaaaaaaaama3vvvvvvwawdaqqqqqqsdangaaaaaaama1vvvvvvwawdsqqqqqqsdanaaaaaaaamazvvvvvvwawdkqqqqqqsdamgaaaaaaamaxvvvvvvwawdcqqqqqqsdamaaaaaaaamauqqqqqqsawc1vvvvvvydalaaaaaaaamaqqqqqqqsawclvvvvvvydakaaaaaaaamamqqqqqqsawcvvvvvvvydajaaaaaaaamaiqqqqqqsawcfvvvvvvydaiaaaaaaaamadvvvvvvyawbqqqqqqqwdagaaaaaaaamavvvvvvvyawbkqqqqqqwdaeaaaaaaaamakqqqqqqwawavvvvvvvgdaaaaaaaaa": 86, "w": [17, 36, 41, 61, 72, 83, 84], "w_stag": 46, "wa": [8, 10, 11, 12, 13, 14, 15, 17, 23, 24, 25, 29, 30, 37, 38, 40, 41, 42, 43, 45, 46, 50, 52, 59, 61, 62, 63, 64, 71, 73, 74, 79, 81, 83, 84, 86, 87, 89, 90], "wai": [2, 7, 8, 10, 11, 14, 17, 23, 24, 29, 31, 39, 45, 53, 59, 63, 67, 69, 71, 72, 73, 74, 75, 78, 80, 84, 86, 88], "wait": [7, 8, 35, 66], "wait_count": 87, "walk": [4, 6, 8, 16, 30, 41, 44, 71, 90, 91], "wall": [22, 23, 43, 46, 51, 52, 67, 68, 83, 84, 86, 87], "wall_tim": 20, "walltim": [20, 22, 43, 46, 52, 87], "want": [6, 8, 10, 11, 12, 13, 14, 15, 20, 22, 23, 25, 28, 29, 35, 38, 39, 43, 45, 46, 50, 52, 53, 59, 61, 62, 63, 67, 68, 69, 71, 73, 74, 80, 81, 82, 84, 87], "war": 15, "warm": 63, "warn": [8, 11, 20, 38, 39, 41, 43, 45, 46, 67, 68, 84, 87], "warren_djf_climo": 41, "wasn": [11, 67, 73, 81], "wast": 16, "watch": [21, 35, 49, 54, 55, 75, 76, 77], "water": [40, 42, 47, 61, 67, 72, 86], "watermark": [72, 83, 84, 86], "waterstagg": 67, "watsat": 80, "wav": 28, "wave": 63, "wavenumb": 46, "wavenumberarrai": 46, "wb": [84, 86], "wc_comp": 14, "wc_data": 14, "wchill": 65, "wdir": 65, "we": [2, 6, 7, 8, 12, 13, 14, 15, 16, 17, 18, 20, 23, 28, 30, 31, 32, 35, 36, 37, 38, 39, 41, 42, 43, 44, 45, 47, 48, 50, 51, 52, 59, 62, 63, 64, 65, 66, 67, 68, 69, 71, 72, 73, 75, 76, 77, 79, 80, 82, 83, 84, 85, 86, 87, 88, 89, 90], "weak": 62, "weather": [8, 12, 23, 30, 31, 61, 67, 78], "web": [0, 8, 39, 44, 59, 63, 75], "webext": 18, "webpag": [6, 8, 23, 37, 39, 44, 50], "websit": [8, 13, 15, 16, 29, 35, 44, 50, 64, 82, 93], "wed": 87, "wednesdai": [8, 16, 19, 21, 26, 27, 34, 35, 40, 49, 54, 55, 58, 63, 66, 88], "week": [8, 20, 23, 29, 38, 39, 43, 50, 51, 52, 61, 62, 63, 79, 85, 88, 90, 91], "weekend": 88, "weekli": [30, 31, 32, 36, 59, 81], "weight": [8, 38, 61, 63, 68, 80, 81, 84], "weight_fil": [72, 83], "weightarrai": 41, "weighted_temporal_mean": [46, 68], "weightsarrai": 46, "weigth": 68, "welcom": [2, 8, 38, 88, 92], "well": [2, 6, 7, 8, 10, 12, 14, 15, 23, 24, 25, 29, 38, 40, 53, 62, 64, 69, 71, 72, 73, 80, 83, 85, 89, 90, 92], "went": [12, 79, 84, 90], "were": [8, 10, 15, 20, 24, 28, 30, 31, 39, 41, 43, 61, 63, 71, 72, 73, 76, 83, 86, 89, 90, 92], "weren": 45, "west": [41, 67], "west_east": 67, "west_east_stag": 67, "westerli": 67, "wet": 86, "wet_c": 86, "wet_u": 86, "wet_v": 86, "wetland": 80, "wget": [12, 50, 61], "wgt": [46, 68], "what": [8, 10, 12, 14, 15, 23, 25, 29, 31, 36, 39, 41, 44, 45, 47, 51, 59, 63, 72, 73, 84, 87, 88, 90], "whatev": 88, "wheel": 29, "when": [0, 4, 5, 6, 8, 10, 11, 12, 13, 14, 15, 17, 20, 23, 25, 28, 29, 31, 36, 37, 39, 41, 42, 43, 44, 45, 46, 47, 48, 50, 53, 57, 59, 61, 62, 63, 65, 67, 68, 69, 71, 73, 80, 81, 83, 84, 86, 87, 90], "whenev": [14, 69, 71], "where": [0, 6, 8, 11, 12, 13, 15, 21, 24, 25, 28, 29, 30, 37, 40, 43, 44, 45, 46, 47, 48, 50, 51, 52, 57, 58, 59, 61, 62, 66, 67, 68, 74, 75, 76, 77, 78, 79, 80, 84, 86], "wherea": [13, 46, 61, 68], "whether": [20, 59, 86], "whhqqqqqqqraceaaaaaaambx1vvvvvvwwhhkqqqqqqraccaaaaaaambxtvvvvvvuwhgqqqqqqqzacaaaaaaaambxlvvvvvvuwhgkqqqqqqzacyaaaaaaambxdvvvvvvuwhfqqqqqqqzacwaaaaaaambxvvvvvvvuwhfkqqqqqqzacuaaaaaaambxnvvvvvvuwheqqqqqqqzacsaaaaaaambxfvvvvvvuwhekqqqqqqzacqaaaaaaambw9vvvvvvuwhdqqqqqqqzacoaaaaaaambw1vvvvvvuwhdkqqqqqqzacmaaaaaaambwtvvvvvvuwhcqqqqqqqzackaaaaaaambwlvvvvvvuwhckqqqqqqzaciaaaaaaambwdvvvvvvuwhbqqqqqqqzacgaaaaaaambwvvvvvvvuwhbkqqqqqqzaceaaaaaaambwnvvvvvvuwhaqqqqqqqzaccaaaaaaambwfvvvvvvuwhakqqqqqqzacaaaaaaaambv6qqqqqqowg": 86, "which": [2, 4, 6, 7, 8, 10, 11, 12, 13, 14, 15, 17, 18, 20, 22, 23, 24, 25, 28, 29, 30, 31, 36, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 50, 51, 52, 53, 57, 59, 61, 62, 63, 64, 65, 67, 68, 69, 71, 73, 76, 79, 80, 83, 84, 87, 88, 89, 93], "while": [8, 13, 15, 16, 23, 24, 25, 29, 30, 37, 39, 41, 42, 43, 44, 46, 48, 52, 61, 62, 72, 81, 82, 83, 86, 88], "white": [13, 63], "whitepap": 32, "whitespac": 15, "who": [8, 10, 11, 12, 15, 16, 42, 63, 67, 71, 75, 76, 82, 92], "whoknowsdescript": 67, "whole": [8, 10, 47, 88], "whom": 15, "whomev": 15, "whose": 80, "why": [8, 10, 11, 13, 16, 45, 69, 73, 80], "wide": [24, 61, 63, 86], "wider": [8, 63, 64], "widespread": 15, "widget_loc": 67, "width": [18, 20, 23, 30, 39, 46, 61, 72, 80, 81], "wife": 15, "wiith": 86, "wikileak": 15, "wikipedia": 80, "wildcard": 37, "willing": 15, "willmott_04_climo": 41, "wind": [16, 38, 63], "wind_spe": 38, "wind_speed_max_plot": 65, "wind_speed_plot": 65, "windmdim": 38, "window": [12, 50, 57, 88], "windspe": [14, 65], "winter": 81, "winter_barlei": 80, "winter_ry": 80, "winter_wheat": 80, "wip": 29, "wisconsin": 40, "wish": [7, 8, 74], "within": [1, 4, 7, 8, 12, 14, 16, 18, 23, 25, 28, 36, 37, 38, 39, 40, 41, 42, 43, 44, 47, 50, 51, 57, 59, 61, 62, 63, 64, 65, 67, 68, 70, 71, 78, 80, 83, 84], "without": [8, 10, 11, 12, 13, 16, 20, 23, 28, 37, 38, 39, 45, 46, 47, 51, 52, 61, 65, 67, 68, 69, 72, 73, 80, 83, 86, 87, 90], "wmax": 65, "wnummax": 46, "woa": 61, "woa18": 61, "woa18_decav_": 61, "woa18_decav_t01_04": 61, "woa_": 61, "woa_tx0": 61, "wolfram": 63, "won": [8, 11, 69], "wonder": 7, "word": [15, 21, 24, 58, 66, 87], "work": [4, 6, 7, 8, 10, 11, 12, 13, 14, 15, 17, 20, 22, 23, 25, 28, 29, 31, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 49, 50, 51, 53, 56, 57, 59, 61, 62, 63, 64, 65, 67, 68, 69, 70, 71, 72, 74, 75, 78, 81, 82, 83, 84, 85, 86, 88, 91, 93], "workaround": [7, 11], "worker": [8, 17, 20, 25, 28, 37, 38, 39, 41, 43, 46, 61, 62, 67, 68, 73, 83, 84, 86, 87, 88], "workflow": [2, 4, 7, 8, 10, 11, 16, 17, 25, 28, 29, 35, 38, 42, 44, 47, 50, 61, 62, 67, 68, 93], "workforc": [2, 8, 88], "workload": [8, 22], "workshop": [8, 63], "workspac": [16, 17, 45, 75, 77], "world": [8, 29, 63], "worldwid": 29, "worri": [14, 74, 84, 88], "worth": [20, 65, 84], "would": [6, 7, 8, 10, 13, 14, 15, 16, 17, 18, 19, 21, 26, 27, 28, 33, 34, 35, 36, 37, 39, 42, 43, 44, 45, 46, 48, 49, 50, 53, 54, 55, 56, 57, 58, 59, 60, 62, 63, 66, 67, 70, 71, 73, 76, 78, 80, 82, 83, 84, 86, 88, 90], "wouldn": 90, "wq": 12, "wrap": [8, 23, 62], "wrf": [8, 30, 31], "wrf_d": 67, "write": [2, 8, 11, 12, 14, 15, 16, 24, 38, 44, 62, 68, 80, 82, 83, 84, 86, 90], "written": [8, 11, 15, 24, 25, 29, 44], "wrong": [10, 72, 73], "wrote": 80, "wsdev": 65, "wspd": 65, "wt": 36, "wtt": 36, "wve": 36, "wvel": 36, "www": [28, 37, 39, 46, 61, 68], "wxobs20170821": [8, 12], "x": [8, 12, 13, 14, 17, 20, 23, 38, 41, 48, 61, 63, 67, 68, 73, 74, 80, 83, 84, 86, 88], "x00": 86, "x27": [38, 39, 41, 46, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "xarai": 29, "xarrai": [6, 8, 10, 11, 20, 23, 24, 26, 27, 28, 29, 37, 38, 39, 41, 42, 43, 44, 46, 51, 63, 65, 71, 72, 73, 75, 76, 77, 82, 83, 84, 85, 87, 92, 93], "xarray_2022_03_09": 70, "xarray_open_kwarg": 38, "xbound": 61, "xc": 17, "xc_a": [72, 83], "xc_b": [72, 83], "xclim": 7, "xcoordinate_defin": [46, 81], "xdev": [8, 13, 16, 17, 23, 24, 29, 32, 56, 82], "xdever": 32, "xdim": 63, "xe": 61, "xemsf": 90, "xesmf": [7, 8], "xgcm": [7, 24, 25, 70], "xh": 86, "xhpandasindexpandasindex": 86, "xi_rho": 73, "xi_rhoxarrai": 73, "xiearkin_09_climo": 41, "xlabel": [20, 37, 46, 81], "xlat_c": 67, "xlat_m": 67, "xlat_u": 67, "xlat_v": 67, "xlim": [37, 81], "xlong_c": 67, "xlong_m": 67, "xlong_nam": 86, "xlong_u": 67, "xlong_v": 67, "xmf87s1j": 41, "xmode": 83, "xmxl_2": 20, "xoak": [8, 25, 32, 83], "xpersist_cach": 47, "xq": 86, "xqpandasindexpandasindex": 86, "xr": [7, 8, 23, 37, 39, 41, 43, 46, 47, 51, 61, 65, 67, 68, 72, 73, 80, 81, 83, 84, 86, 87], "xskillscor": 7, "xsparse_weight": 83, "xsparse_wgt": 83, "xtick": [37, 81], "xv": 17, "xv_a": [72, 83], "xv_b": [72, 83], "xwan": [23, 51], "xwrf": [30, 31], "xxxxxxxx": 52, "xy": [15, 67], "xyzunit": 67, "y": [8, 15, 17, 20, 23, 36, 38, 41, 47, 61, 63, 67, 68, 80, 83, 86], "y402nce5": 41, "yaml": [22, 44, 52], "yarnclust": 62, "yarrai": 87, "ybound": [38, 61], "yc": 17, "yc_a": [72, 83], "yc_b": [72, 83], "ycoordinate_defin": [46, 81], "ydim": 63, "ye": [12, 14, 15, 29, 45, 53, 73, 90], "yeager": [8, 23, 32, 42], "year": [8, 10, 11, 20, 24, 28, 29, 38, 41, 46, 59, 63, 64, 68, 80, 81, 83, 87, 89, 90], "yearli": 46, "yearly_average_weighted_correctli": 68, "yearly_average_weighted_incorrectli": 68, "yearsgrid_map": 61, "yellow": 0, "yet": [2, 8, 11, 28, 32, 38, 50, 52, 73, 84], "yh": 86, "yhpandasindexpandasindex": 86, "yield": [2, 14, 17, 42], "ylabel": [20, 37, 46, 65, 81], "ylgn": 80, "ylim": [47, 81], "ylm": 47, "ylong_nam": 86, "yml": [1, 7, 19, 21, 26, 27, 33, 34, 40, 44, 55, 58, 66, 70, 78], "you": [0, 1, 4, 6, 7, 8, 11, 12, 13, 14, 15, 16, 17, 19, 20, 21, 22, 23, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 48, 49, 50, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 73, 74, 75, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 92], "your": [0, 1, 4, 6, 7, 8, 11, 12, 14, 15, 16, 19, 20, 21, 22, 25, 26, 27, 28, 29, 30, 32, 34, 35, 36, 40, 43, 45, 48, 49, 51, 52, 53, 54, 55, 56, 58, 60, 62, 63, 64, 66, 67, 68, 70, 71, 73, 75, 76, 78, 79, 80, 81, 82, 87, 90, 92], "your_address": 15, "your_nam": 15, "your_titl": 15, "yourproject": 12, "yourself": 88, "youtub": [40, 92], "yq": 86, "yqpandasindexpandasindex": 86, "ytick": [37, 81], "yv": 17, "yv6ztsj": 41, "yv_a": [72, 83], "yv_b": [72, 83], "yxc": 83, "yxt": 83, "yyi": 11, "yyyymm": 42, "yyyymmdd": [72, 80, 83, 84], "yz": 15, "z": [23, 61, 67, 68], "z3": 41, "z_i": 86, "z_ilong_nam": 86, "z_l": 86, "z_t": [18, 28, 39, 43, 47, 61, 68], "zacharia": [8, 19, 34, 49, 76, 77, 92], "zarr": [7, 20, 28, 32, 36, 41, 46, 61, 62, 63, 68, 84], "zarr_format": 86, "zarr_group_entri": 86, "zarr_kwarg": 46, "zarrai": [61, 86], "zarrstor": 61, "zattr": 86, "zedg": 86, "zenodo": [29, 63, 64], "zero": [10, 61, 80], "zgroup": 86, "zip": [14, 17], "zlake": 80, "zlon": 84, "zlon_bnd": 84, "zlon_bndsarrai": 84, "zlon_bndslong_nam": 84, "zlong_nam": 86, "zlonpandasindexpandasindex": 84, "zonal": [38, 86, 93], "zone": [25, 32], "zoom": [8, 12, 23, 39, 40, 57, 63, 75, 77, 79, 85, 91], "zorder": 81, "zsh": 12, "zshrc": 12, "zsoi": 80, "zuckerberg": 63, "zulip": [7, 8, 29, 51, 80, 88], "zweng": 61, "zwk0f96c": 37, "zxarrai": 61, "\u00b5": [23, 83], "\u03c3": 47}, "titles": ["ESDS Blog Contributors Guide", "Earth System Data Science (ESDS)", "About Us", "Accessibility", "Best Practices", "Blog", "Communication, Meetings, and Resources", "Frequently Asked Questions", "Earth System Data Science (ESDS) Initiative", "Office Hours", "We are Xdev!", "The Significance of Time", "Python Tutorial FAQ", "Python Tutorial FAQ - Part 2", "Python Tutorial FAQ - Part 3", "Templating isn\u2019t just for Web Developers!", "Tutorial Seminar Series", "Writing multiple netCDF files in parallel with xarray and dask", "HiRes-CESM Interactive Dashboard Example", "Advanced Plotting Tutorial", "Benchmarking Performance of History vs. Timeseries Files with ecgtools, Intake-ESM, and Dask", "Cartopy Tutorial", "Using Dask on the New Casper PBS Scheduler", "Plotting CESM Data on an Unstructured Grid using Geoviews and Datashader", "CESM Diagnostics Discussion", "Dask Distributed Summit 2021 Takeaways", "Dask Tutorial", "Dask Tutorial UPDATED DATES", "Building an Intake-esm catalog from CESM2 History Files", "NCAR-CGD ESDS Town Hall", "ESDS Update November 2021", "ESDS Update October 2021", "ESDS Progress Over the Past Few Months", "GeoCAT-Comp Tutorial", "Plotting with GeoCAT Tutorial", "Git and GitHub Tutorial", "Creating Visualizations of Intake-ESM Catalogs", "Using Intake-ESM to Analyze Data from CESM2-LE", "Using Intake-ESM\u2019s New Derived Variable Functionality", "Examining Diagnostics Using Intake-ESM and hvPlot", "Intake-ESM Tutorial", "Comparing Atmospheric Model Output with Observations Using Intake-ESM", "Debugging Intake-ESM Process for Reading in CMIP6", "An Example of Using Intake-ESM", "Reimagining Diagnostics Through the Use of the Jupyter Ecosystem", "Jupyter Notebooks Tutorial FAQ", "CESM2-Large Ensemble Reproduction of Kay et al. 2015", "How to Use xarray.map_blocks for Vertical Interpolation of a 3D Field", "Matplotlib Tutorial FAQ", "Matplotlib Tutorial", "Creating Model Documentation Using Jupyterbook and Intake-esm", "Indexing unstructured grids with the Power of Xoak", "NCAR-Jobqueue", "NumPy Tutorial FAQ", "Numpy Tutorial", "Object Oriented Programming Tutorial", "Object Oriented Programming Tutorial", "Paired Programming using VS Code", "Pandas Tutorial", "Project Pythia Portal Overview", "Python Tutorial Seminar Series - Spring 2021", "Regridding High Resolution Observations to a High Resolution Model Grid", "Scaling Python with Dask Class Takeaways", "SciPy Conference 2021 Takeaways", "The Importance of Software Citation", "Processing Data from the NCAR Mesa Lab Weather Station", "Xarray Tutorial", "Reading WRF data into Xarray and Visualizing the Output using hvPlot", "Correctly Calculating Annual Averages with Xarray", "Your First Package Python Tutorial FAQ", "\u201cThinking with Xarray\u201d Tutorial", "Batch Processing Jupyter Notebooks with Papermill", "Regridding using xESMF and an existing weights file", "Debugging dask workflows: Detrending", "What I\u2019ve learned about debugging", "Preparation for a (Re)Introduction to Earth System Data Science (ESDS) Across NCAR/UCAR/UCP", "Recap of a (Re)Introduction to Earth System Data Science (ESDS) Across NCAR/UCAR/UCP", "A (Re)Introduction to Earth System Data Science (ESDS) Across NCAR/UCAR/UCP", "MetPy Tutorial", "New Office Hours Appointment System", "Sparse arrays and the CESM land model component", "Calculating Temporal Averages with GeoCAT-comp vs Xarray", "The Python Tutorial Series Returns this Summer!", "Analyzing and visualizing CAM-SE output in Python", "Cloud-optimized access to CESM Timeseries netCDF files in the Cloud with kerchunk", "2024 Earth System Data Science (ESDS) Annual Event", "Virtual aggregate CESM MOM6 datasets with kerchunk", "Thinking through CESM data access", "ESDS Office Hours Support", "ESDS at SciPy 2023", "Recap: Unstructured Grid Collaborative Work Time", "Workshop - From Jupyter Notebook to Web Server: Containerizing Interactive Visualizations", "2024 ESDS Annual Event Recap", "Projects"], "titleterms": {"": [24, 28, 30, 31, 38, 73, 81], "0": 61, "08": 32, "09": 32, "1": [4, 32, 57, 71, 83], "10": 32, "11": 32, "12": 32, "14": 32, "2": [13, 32, 57, 71, 73, 83], "20": 39, "2015": 46, "2021": [25, 30, 31, 32, 60, 63], "2023": 89, "2024": [85, 92], "23": 32, "24": [32, 61], "25": 32, "26": 32, "3": [14, 57, 71, 83], "3d": 47, "4": [4, 57, 83], "5": 57, "53": 61, "A": [73, 77], "Near": 2, "The": [11, 15, 59, 61, 64, 65, 68, 81, 82], "These": 20, "_config": 50, "_toc": 50, "about": [2, 74], "absolut": 18, "access": [3, 7, 18, 20, 32, 46, 84, 87], "acknowledg": [76, 92], "across": [75, 76, 77], "action": 44, "activ": 6, "ad": [41, 50], "adapt": 83, "add": [38, 50, 61, 74, 83], "addit": [28, 81], "adf": 93, "advanc": [19, 31], "advic": 7, "again": 73, "agenda": 76, "aggreg": 86, "al": 46, "all": [65, 80, 81], "am": 64, "amazon": 84, "an": [23, 28, 38, 41, 43, 44, 61, 65, 72, 73, 83, 84, 89], "anaconda": 25, "analysi": [4, 6, 7, 44, 89], "analyz": [37, 83], "annual": [38, 43, 46, 68, 85, 92], "anoth": 71, "answer": [7, 29], "appendix": 20, "appli": [20, 23, 37, 38, 42, 43, 47, 72, 80, 83], "apply_ufunc": 80, "appoint": [79, 88], "approach": 84, "april": 32, "ar": [7, 10, 24, 61], "arch": 24, "architectur": 4, "area": 46, "around": 61, "arrai": [37, 80, 83], "asid": 80, "ask": [7, 29], "assumpt": 35, "atla": 61, "atmospher": [41, 63, 93], "attempt": 73, "attend": 91, "august": 32, "authent": 7, "autom": [44, 89], "avail": 84, "averag": [39, 41, 46, 68, 81], "awsig": 6, "axi": 65, "back": [25, 80], "background": [63, 71], "batch": [22, 71], "befor": [24, 35], "below": 46, "benchmark": [20, 84], "best": [4, 11, 62], "beta": 28, "better": [24, 73, 87, 89], "binder": 75, "bio": [40, 56, 70, 78, 82], "blog": [0, 5, 30, 31, 32], "book": [44, 50, 59], "both": 11, "branch": 50, "breakout": 76, "bring": [20, 65, 89], "bucket": 84, "bug": 73, "build": [1, 18, 20, 28, 41, 44, 50, 73, 83, 89], "built": 89, "calcul": [38, 43, 46, 47, 65, 68, 81], "calendar": [6, 16, 82], "call": 38, "cam": 83, "can": [7, 25, 52], "cartopi": [21, 32], "case": [11, 15, 36], "casper": [22, 52], "catalog": [20, 28, 36, 37, 41, 46, 50, 93], "caus": 42, "celebr": 74, "cell": 44, "cesm": [7, 18, 23, 24, 36, 41, 43, 50, 80, 84, 86, 87, 93], "cesm2": [28, 37, 41, 46, 68], "cftime": 11, "cgd": [29, 90], "challeng": [37, 63, 73, 81], "chang": 74, "check": 74, "checkout": 50, "choos": 87, "chunk": [83, 87], "cisl": 90, "citat": [29, 32, 64], "cite": 64, "class": 62, "client": 83, "climat": 89, "climatologi": 41, "clm": 80, "clone": 50, "cloud": 84, "cluster": [20, 37, 38, 39, 43, 46, 62, 67, 68, 83, 84, 87], "cmip6": 42, "code": [7, 17, 44, 57, 74], "codebas": 74, "collabor": [57, 90, 92], "colleagu": 24, "colorbar": 61, "combin": [43, 86, 87], "come": 24, "command": [7, 71], "comment": [24, 63], "committe": 2, "commun": [2, 6, 24, 63, 80, 93], "comp": [32, 33, 61, 81, 93], "compar": [41, 61], "comparison": [20, 39], "compon": [36, 50, 80], "compress": 80, "comput": [4, 17, 20, 25, 29, 30, 31, 32, 39, 41, 46, 61, 62, 81, 83], "concaten": 87, "conclus": [17, 20, 28, 36, 37, 39, 41, 44, 50, 61, 62, 65, 67, 68], "conda": [7, 20, 30], "confer": [32, 63], "config": 50, "configur": 44, "confirm": 17, "conlcus": 23, "consid": 88, "construct": [72, 80, 83], "contain": 18, "container": 91, "content": [44, 50, 83], "contribut": [24, 89], "contributor": 0, "convert": [46, 65, 80], "coordin": 83, "copi": 50, "core": 83, "correct": 81, "correctli": 68, "could": 24, "cover": 35, "creat": [7, 17, 36, 38, 39, 50, 83, 84, 86, 87, 88], "csv": 18, "ctsm": 93, "cube": 89, "cupid": 93, "d": 83, "dagon": 90, "daili": 46, "dashboard": [18, 62], "dask": [7, 17, 20, 22, 25, 26, 27, 29, 30, 31, 32, 37, 38, 39, 43, 52, 62, 73, 80, 87], "data": [1, 7, 8, 18, 23, 28, 29, 30, 31, 32, 37, 38, 39, 41, 43, 46, 47, 61, 62, 63, 65, 67, 68, 72, 75, 76, 77, 81, 83, 85, 86, 87, 89], "dataarrai": 80, "datafram": 46, "dataset": [17, 23, 37, 39, 41, 43, 46, 47, 67, 86, 87], "datashad": 23, "datatre": 86, "date": [27, 60], "datetime64": 11, "datetimenoleap": 11, "deal": [7, 18, 65], "debug": [7, 42, 73, 74], "defin": [37, 83], "demo": 86, "demonstr": 81, "depth": 47, "deriv": 38, "describ": 23, "design": [4, 29], "desir": 37, "destin": 83, "determin": 42, "detrend": 73, "develop": [15, 24, 38, 63], "diagnost": [24, 29, 39, 44, 93], "dictionari": [39, 86], "differ": [20, 52, 68, 81], "dimens": [80, 83], "direct": 83, "directli": [84, 89], "directori": [28, 50], "discoveri": 63, "discuss": [24, 30, 31, 32], "disk": [43, 87], "distribut": [25, 62, 83], "do": [7, 24, 29, 64], "doc": 50, "document": [23, 32, 50, 74], "doi": 64, "down": 46, "download": [28, 50, 57], "each": 84, "earth": [1, 8, 75, 76, 77, 85, 93], "easi": 80, "ecgtool": [20, 28, 41, 93], "ecosystem": 44, "effort": 93, "els": 64, "email": 6, "enabl": [24, 57], "end": [30, 31, 32, 89], "engin": 24, "ensembl": 46, "entir": [47, 80], "environ": [7, 71, 75], "eroglu": 90, "error": [42, 74], "esd": [0, 1, 2, 6, 8, 25, 29, 30, 31, 32, 75, 76, 77, 85, 88, 89, 92], "esm": [20, 28, 36, 37, 38, 39, 40, 41, 42, 43, 46, 50, 93], "esm_catalog_util": 93, "et": 46, "evalu": 89, "event": [2, 76, 85, 92], "exactli": 67, "examin": [39, 67], "exampl": [18, 22, 32, 36, 43, 73, 86, 93], "execut": 71, "exist": 72, "experi": [35, 41], "export": 7, "extract": [46, 83], "fair": 50, "falko": 90, "faq": [12, 13, 14, 45, 48, 53, 69], "far": [16, 82], "featur": 24, "fernando": 63, "few": 32, "field": 47, "file": [7, 17, 18, 20, 28, 41, 44, 50, 67, 72, 83, 84, 86, 87], "filepath": 17, "filesystem": 86, "final": [39, 71, 73], "find": [7, 29], "first": [69, 83, 87], "fix": [61, 73], "follow": 60, "forg": [20, 61], "format": 81, "forum": [6, 25, 30, 31], "foundat": 59, "framework": 93, "frequenc": 50, "frequent": 7, "friendli": 89, "from": [24, 28, 37, 39, 41, 46, 50, 61, 65, 71, 81, 84, 91], "function": [7, 17, 23, 37, 38, 39, 41, 61, 65, 68, 81, 83], "fund": 29, "further": [80, 83], "futur": 73, "galleri": [59, 93], "garden": 89, "gather": 84, "gener": [7, 17, 30, 31, 84, 86, 93], "geocat": [32, 33, 34, 61, 81, 93], "geospati": 89, "geoview": 23, "git": [32, 35], "github": [6, 7, 32, 35, 44, 50], "given": 24, "go": [7, 50], "goal": [2, 80], "gpu": 89, "grab": [46, 67], "graphviz": 36, "grid": [23, 46, 51, 61, 83, 90], "group": [2, 6, 24, 37, 76, 86], "growth": 25, "guid": [0, 76], "h": 86, "hall": 29, "have": 7, "heatwav": 63, "help": [4, 7], "helper": [17, 37, 39, 61, 81], "here": 61, "high": [25, 61], "hire": 18, "histor": 41, "histori": [20, 25, 28, 50], "holoview": [23, 39], "home": 89, "homework": 75, "hour": [6, 9, 30, 31, 32, 79, 88], "how": [7, 24, 25, 29, 38, 40, 44, 47, 52, 56, 64, 70, 71, 78, 82], "hpc": [4, 7, 25], "hvplot": [39, 61, 67], "i": [7, 38, 52, 61, 64, 67, 71, 73, 74, 80, 86, 91], "imag": 63, "import": [17, 20, 23, 28, 36, 37, 38, 39, 41, 43, 46, 47, 50, 61, 64, 65, 67, 68, 80, 81, 83, 84], "improv": [47, 72], "incorpor": 24, "incorrect": 81, "incorrectli": 68, "index": 51, "info": 81, "ingest": 47, "inherit": 15, "initi": 8, "inlin": [18, 86], "input": 17, "insight": 63, "inspect": 28, "instal": [20, 38, 50, 67, 75], "instead": 83, "intak": [20, 28, 36, 37, 38, 39, 40, 41, 42, 43, 46, 50, 93], "interact": [18, 29, 44, 61, 65, 89, 91], "intercomparison": 20, "interest": [6, 61], "interpol": [47, 61], "introduct": [46, 62, 75, 76, 77, 80], "intuit": 74, "investig": [41, 67], "invit": 92, "invok": 17, "isn": 15, "jinja2": 15, "jobqueu": 52, "join": [60, 88], "judt": 90, "juli": 32, "june": 32, "jupyt": [36, 44, 45, 71, 89, 91], "jupyterbook": 50, "jupyterhub": 7, "just": [15, 20, 80], "kai": 46, "kati": 90, "keep": 89, "kerchunk": [84, 86], "keynot": 63, "kill": 7, "killedwork": 7, "lab": 65, "land": 80, "landscap": 29, "larg": 46, "last": 39, "layer": 47, "lazili": 46, "le": [36, 37, 41, 43, 68], "leadership": 2, "learn": [6, 59, 74, 81, 89], "let": 73, "letter": 15, "level": [61, 67], "librari": 80, "line": [7, 71], "link": [25, 50], "list": [6, 67, 84, 87], "load": [17, 38, 39, 46, 68], "local": [1, 20, 75], "locat": 83, "login": [22, 57], "logo": 50, "long": [7, 89], "look": [7, 37, 44, 62, 68, 73], "loop": 36, "lot": 7, "machin": [50, 89], "mai": 32, "main": [24, 36, 37], "make": [61, 64, 80, 81, 83, 87], "mamba": 7, "manag": 4, "mani": 80, "map": [61, 83, 84], "map_block": 47, "mapper": [84, 86], "march": 32, "marin": 63, "markdown": 44, "materi": 76, "matplotlib": [30, 31, 32, 48, 49], "matrix": 83, "matter": 87, "me": 17, "mean": [38, 41, 43, 46, 61], "meet": [6, 24, 57], "member": 2, "membership": 6, "memori": 7, "merg": 84, "mesa": 65, "messag": 74, "metadata": 18, "meteogram": 65, "method": [61, 83, 84], "metpi": [78, 89], "mindset": 74, "mint": 64, "mix": 47, "mmm": 90, "model": [4, 29, 41, 50, 61, 63, 80, 89, 93], "modifi": 67, "modular": 93, "mom6": [86, 93], "monitor": [7, 63], "month": 32, "monthli": [7, 20, 39, 41, 61, 81], "morpholog": 63, "motiv": 71, "much": [7, 24], "multipl": [7, 17, 80], "multipli": 83, "must": 7, "my": [7, 52, 64], "nbscuid": 93, "ncar": [4, 7, 29, 52, 64, 65, 75, 76, 77, 89], "netcdf": [17, 84], "new": [7, 22, 24, 38, 52, 63, 65, 79, 87, 88], "next": 86, "note": 87, "notebook": [36, 44, 45, 71, 89, 91], "novemb": 30, "npl": 7, "nsf": [4, 7], "numpi": [25, 32, 53, 54], "object": [30, 32, 55, 56], "observ": [41, 46, 61], "ocean": [20, 61, 93], "ocetrac": 63, "octob": 31, "offic": [6, 9, 30, 31, 32, 79, 88], "older": 73, "one": 37, "onto": 83, "open": [63, 87, 89], "open_dataset": 86, "oper": [43, 47, 73, 80], "opportun": 47, "opt_einsum": 83, "optim": [7, 84], "option": [71, 87], "organ": [6, 64], "orhan": 90, "orient": [30, 32, 55, 56], "other": 89, "our": [23, 37, 38, 39, 42, 44, 46, 65], "out": 20, "output": [7, 17, 20, 38, 39, 41, 46, 47, 67, 80, 83, 84, 86], "outsid": 64, "over": [24, 32], "overal": 29, "overview": [24, 30, 31, 32, 59, 62, 83, 92], "own": 88, "packag": [4, 17, 20, 24, 29, 30, 31, 32, 69], "page": [7, 50], "pair": 57, "panda": [32, 58], "pangeo": [25, 61], "papermil": 71, "parallel": [7, 17, 29, 93], "parameter": 44, "pars": 41, "parse_cesm_histori": 20, "parse_cesm_timeseri": 20, "parser": [20, 41], "part": [13, 14, 32], "particip": 6, "past": [2, 32, 35], "path": 18, "pb": 22, "peopl": 64, "perez": 63, "perform": [17, 20, 25, 83], "pipelin": [87, 89], "plan": 90, "platform": 6, "pleas": [17, 60], "plot": [18, 19, 20, 23, 31, 34, 37, 38, 39, 41, 44, 46, 61, 65, 67, 80, 81, 84], "polyfit": 73, "polyv": 73, "pop": [29, 93], "portal": 59, "portion": 29, "possibl": 72, "post": [8, 30, 31, 32], "poster": 89, "postprocess": 93, "potenti": 47, "power": 51, "practic": [4, 62], "prepar": [19, 21, 26, 27, 33, 34, 35, 46, 49, 54, 55, 58, 66, 71, 75], "preprocess": [44, 87], "preprocessor": 65, "present": 76, "print": 74, "problem": [65, 68, 74], "process": [42, 63, 65, 71], "program": [30, 32, 55, 56, 57, 93], "progress": 32, "project": [6, 29, 59, 89, 93], "properli": 17, "public": 29, "push": 50, "put": 80, "pythia": [6, 59, 89], "python": [12, 13, 14, 30, 31, 32, 60, 62, 69, 71, 82, 83, 93], "queri": [37, 41], "question": [7, 29, 30, 31, 80], "re": [75, 76, 77], "read": [7, 18, 20, 23, 28, 36, 37, 38, 39, 41, 42, 43, 46, 50, 61, 67, 72, 81, 83, 84, 86, 87], "rebuild": 50, "recap": [76, 90, 92], "recent": 8, "rechunk": 7, "record": [40, 76], "refer": [84, 86], "registr": 91, "registri": 38, "regrid": [61, 72, 83], "regridd": [72, 83], "reimagin": 44, "rel": 18, "remap": 83, "remot": 57, "repositori": [4, 6, 50, 64], "repres": 2, "reproduc": 42, "reproduct": 46, "requir": 24, "reshap": 83, "resolut": 61, "resourc": [4, 6, 7, 32, 59, 76, 92], "result": [23, 37], "return": [37, 82], "run": [18, 40, 47, 56, 63, 70, 71, 78, 82], "s3": 84, "same": 81, "sampl": [41, 50], "save": [20, 28, 41, 50, 62], "save_mfdataset": 17, "scalabl": 89, "scale": [62, 83], "schedul": 22, "scienc": [1, 8, 75, 76, 77, 85], "scientif": [4, 89], "scipi": [25, 63, 89], "script": 71, "se": 83, "search": [20, 43, 74], "season": [41, 46, 81], "seminar": [16, 60], "septemb": 32, "seri": [16, 60, 82], "server": 91, "session": [25, 75], "set": [7, 43, 44, 83], "setup": [23, 46, 57, 65, 73, 86], "sfc": 86, "share": 57, "shift": 29, "should": [64, 91], "show": 17, "sicenc": 63, "sign": [16, 19, 21, 26, 27, 33, 34, 35, 40, 49, 54, 55, 56, 58, 60, 66, 70, 78, 82], "signific": 11, "simpl": 86, "singl": [80, 86, 87], "site": 1, "size": 87, "slide": 76, "slow": 7, "small": 87, "so": [16, 81, 82], "softwar": [4, 24, 64], "solut": [65, 68], "solv": 7, "some": [17, 46], "someon": 7, "someth": 7, "sourc": [63, 83, 89], "space": 83, "spars": [80, 83], "special": 6, "speed": 20, "spin": [20, 37, 38, 39, 43, 46, 67, 68, 83, 84], "split": 17, "spring": 60, "standard": 65, "start": [7, 59, 87], "statement": [15, 74], "static": 86, "station": 65, "step": [7, 71, 88], "structur": [28, 41, 83], "sub": 17, "subset": [37, 39, 46, 61, 87], "success": 63, "summari": [32, 73, 80, 83, 84, 86], "summer": 82, "summit": 25, "support": 88, "sure": [61, 64], "surfac": 83, "sustain": 89, "system": [1, 8, 25, 75, 76, 77, 79, 85, 93], "t": [15, 41, 83], "tabl": [44, 50], "take": [7, 44, 68], "takeawai": [24, 25, 62, 63, 90], "talk": [25, 32, 74, 89, 92], "task": 11, "team": 88, "technic": 29, "temperatur": [41, 46, 65, 83], "templat": [4, 15], "tempor": [39, 46, 81], "temptat": 11, "term": [2, 89], "terrestri": 93, "test": [20, 50, 80, 83, 87], "than": 52, "them": 7, "theme": 24, "thi": [7, 23, 25, 35, 47, 52, 63, 82, 83], "think": [24, 70, 87], "thought": 71, "through": [36, 44, 61, 87], "tidi": 89, "tie": 25, "time": [7, 11, 20, 61, 65, 67, 83, 90, 92], "timeseri": [20, 84], "timestep": [80, 83], "tip": [1, 7], "to_dataset_dict": [37, 38, 46], "togeth": [20, 65, 80, 84], "toi": 17, "too": 7, "tool": [29, 89, 93], "toolkit": 63, "toolsin": 63, "topic": 7, "total": 46, "town": 29, "traiangul": 23, "transpar": 29, "trefht": 46, "tribul": 11, "trimesh": 23, "trust": 74, "try": 87, "tutori": [7, 12, 13, 14, 16, 19, 21, 26, 27, 30, 31, 32, 33, 34, 35, 40, 45, 48, 49, 53, 54, 55, 56, 58, 60, 66, 69, 70, 78, 82, 89, 92], "two": 20, "type": 88, "u": [2, 60], "ucar": [75, 76, 77, 89], "ucp": [75, 76, 77], "understand": [28, 86], "unidata": 89, "unifi": 93, "unit": 65, "unstructur": [23, 51, 90], "up": [7, 16, 19, 20, 21, 26, 27, 33, 34, 35, 37, 38, 39, 40, 41, 43, 44, 46, 49, 54, 55, 56, 58, 60, 66, 67, 68, 70, 72, 78, 82, 83, 84], "updat": [25, 27, 30, 31, 52], "us": [7, 15, 20, 22, 23, 24, 28, 36, 37, 38, 39, 41, 43, 44, 46, 47, 50, 52, 57, 61, 65, 67, 71, 72, 80, 83, 86, 89], "usabl": 29, "user": [24, 25, 89], "util": 86, "uxarrai": 93, "v": [18, 20, 57, 81], "valu": [2, 41, 67], "variabl": [37, 38, 67, 83], "ve": 74, "vector": 83, "vegtyp": 80, "version": [28, 38, 73], "vertic": [47, 61, 67], "via": 20, "view": 50, "virtual": [57, 60, 86], "vision": 2, "visual": [20, 32, 36, 47, 50, 67, 72, 80, 83, 91], "viz": [32, 93], "volunt": 24, "wai": 81, "wall": 20, "want": [7, 64, 88], "warn": 50, "we": [10, 24, 25, 29, 46, 61, 81], "weather": 65, "web": [15, 91], "weight": [46, 72, 83], "well": 67, "were": 17, "what": [7, 24, 28, 38, 62, 67, 71, 74, 80, 81, 86, 91], "when": [7, 74], "where": 7, "which": 37, "who": 91, "whole": 87, "why": [44, 62, 64], "wind": 65, "within": [24, 52], "without": 84, "work": [2, 24, 32, 73, 80, 87, 89, 90, 92], "workaround": 42, "worker": 7, "workflow": [6, 24, 30, 31, 32, 52, 73, 89], "workshop": [24, 91], "world": [11, 61], "would": [24, 52, 64], "wrap": [65, 68, 72, 80], "wrf": 67, "write": [7, 17, 29, 43], "written": [7, 17], "wrong": 7, "x": 7, "xarrai": [7, 17, 25, 30, 31, 32, 47, 61, 62, 66, 67, 68, 70, 80, 81, 86, 89], "xdev": [10, 30, 31], "xesmf": [61, 72, 83], "xoak": 51, "xr": 17, "xwrf": 67, "year": [37, 39, 61], "yearli": 68, "yml": 50, "you": 24, "your": [24, 50, 57, 69, 74, 88], "yourself": 74, "zarr": [29, 86], "zen": 4, "zulip": 6}}) \ No newline at end of file